Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-orzP/Ldr(toxin)
Location 312630..312852 Replicon chromosome
Accession NZ_CP041628
Organism Escherichia coli strain PE15

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag FNZ59_RS01520 Protein ID WP_000170963.1
Coordinates 312630..312737 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name orzP
Locus tag -
Coordinates 312785..312852 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FNZ59_RS01490 307941..309023 + 1083 WP_000804726.1 peptide chain release factor 1 -
FNZ59_RS01495 309023..309856 + 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -
FNZ59_RS01500 309853..310245 + 393 WP_000200373.1 invasion regulator SirB2 -
FNZ59_RS01505 310249..311058 + 810 WP_001257044.1 invasion regulator SirB1 -
FNZ59_RS01510 311094..311948 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
FNZ59_RS01515 312095..312202 - 108 WP_000170951.1 type I toxin-antitoxin system toxin Ldr family protein -
- 312250..312316 + 67 NuclAT_27 - -
- 312250..312316 + 67 NuclAT_27 - -
- 312250..312316 + 67 NuclAT_27 - -
- 312250..312316 + 67 NuclAT_27 - -
- 312250..312316 + 67 NuclAT_28 - -
- 312250..312316 + 67 NuclAT_28 - -
- 312250..312316 + 67 NuclAT_28 - -
- 312250..312316 + 67 NuclAT_28 - -
- 312250..312316 + 67 NuclAT_29 - -
- 312250..312316 + 67 NuclAT_29 - -
- 312250..312316 + 67 NuclAT_29 - -
- 312250..312316 + 67 NuclAT_29 - -
- 312250..312316 + 67 NuclAT_30 - -
- 312250..312316 + 67 NuclAT_30 - -
- 312250..312316 + 67 NuclAT_30 - -
- 312250..312316 + 67 NuclAT_30 - -
- 312250..312316 + 67 NuclAT_31 - -
- 312250..312316 + 67 NuclAT_31 - -
- 312250..312316 + 67 NuclAT_31 - -
- 312250..312316 + 67 NuclAT_31 - -
- 312250..312316 + 67 NuclAT_32 - -
- 312250..312316 + 67 NuclAT_32 - -
- 312250..312316 + 67 NuclAT_32 - -
- 312250..312316 + 67 NuclAT_32 - -
- 312252..312317 + 66 NuclAT_16 - -
- 312252..312317 + 66 NuclAT_16 - -
- 312252..312317 + 66 NuclAT_16 - -
- 312252..312317 + 66 NuclAT_16 - -
- 312252..312317 + 66 NuclAT_18 - -
- 312252..312317 + 66 NuclAT_18 - -
- 312252..312317 + 66 NuclAT_18 - -
- 312252..312317 + 66 NuclAT_18 - -
- 312252..312317 + 66 NuclAT_20 - -
- 312252..312317 + 66 NuclAT_20 - -
- 312252..312317 + 66 NuclAT_20 - -
- 312252..312317 + 66 NuclAT_20 - -
- 312252..312317 + 66 NuclAT_22 - -
- 312252..312317 + 66 NuclAT_22 - -
- 312252..312317 + 66 NuclAT_22 - -
- 312252..312317 + 66 NuclAT_22 - -
- 312252..312317 + 66 NuclAT_24 - -
- 312252..312317 + 66 NuclAT_24 - -
- 312252..312317 + 66 NuclAT_24 - -
- 312252..312317 + 66 NuclAT_24 - -
- 312252..312317 + 66 NuclAT_26 - -
- 312252..312317 + 66 NuclAT_26 - -
- 312252..312317 + 66 NuclAT_26 - -
- 312252..312317 + 66 NuclAT_26 - -
FNZ59_RS01520 312630..312737 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 312785..312852 + 68 NuclAT_15 - Antitoxin
- 312785..312852 + 68 NuclAT_15 - Antitoxin
- 312785..312852 + 68 NuclAT_15 - Antitoxin
- 312785..312852 + 68 NuclAT_15 - Antitoxin
- 312785..312852 + 68 NuclAT_17 - Antitoxin
- 312785..312852 + 68 NuclAT_17 - Antitoxin
- 312785..312852 + 68 NuclAT_17 - Antitoxin
- 312785..312852 + 68 NuclAT_17 - Antitoxin
- 312785..312852 + 68 NuclAT_19 - Antitoxin
- 312785..312852 + 68 NuclAT_19 - Antitoxin
- 312785..312852 + 68 NuclAT_19 - Antitoxin
- 312785..312852 + 68 NuclAT_19 - Antitoxin
- 312785..312852 + 68 NuclAT_21 - Antitoxin
- 312785..312852 + 68 NuclAT_21 - Antitoxin
- 312785..312852 + 68 NuclAT_21 - Antitoxin
- 312785..312852 + 68 NuclAT_21 - Antitoxin
- 312785..312852 + 68 NuclAT_23 - Antitoxin
- 312785..312852 + 68 NuclAT_23 - Antitoxin
- 312785..312852 + 68 NuclAT_23 - Antitoxin
- 312785..312852 + 68 NuclAT_23 - Antitoxin
- 312785..312852 + 68 NuclAT_25 - Antitoxin
- 312785..312852 + 68 NuclAT_25 - Antitoxin
- 312785..312852 + 68 NuclAT_25 - Antitoxin
- 312785..312852 + 68 NuclAT_25 - Antitoxin
FNZ59_RS01525 313142..314242 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
FNZ59_RS01530 314512..314742 + 231 WP_001146444.1 putative cation transport regulator ChaB -
FNZ59_RS01535 314900..315595 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
FNZ59_RS01540 315639..315992 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
FNZ59_RS01545 316178..317572 + 1395 WP_077491895.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T128861 WP_000170963.1 NZ_CP041628:c312737-312630 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T128861 NZ_CP041628:c312737-312630 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAATCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT128861 NZ_CP041628:312785-312852 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References