Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-agrB/Ldr(toxin) |
Location | 1253396..1253617 | Replicon | chromosome |
Accession | NZ_CP041623 | ||
Organism | Escherichia coli O157:H7 strain ATCC 43888 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | FNZ21_RS05905 | Protein ID | WP_001295224.1 |
Coordinates | 1253396..1253503 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | agrB | ||
Locus tag | - | ||
Coordinates | 1253552..1253617 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FNZ21_RS05880 | 1248649..1249401 | - | 753 | Protein_1134 | cellulose biosynthesis protein BcsQ | - |
FNZ21_RS05885 | 1249413..1249601 | - | 189 | WP_001063316.1 | YhjR family protein | - |
FNZ21_RS05890 | 1249874..1251445 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
FNZ21_RS05895 | 1251442..1251633 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
FNZ21_RS05900 | 1251630..1253309 | + | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
FNZ21_RS05905 | 1253396..1253503 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 1253552..1253617 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 1253552..1253617 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 1253552..1253617 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 1253552..1253617 | + | 66 | NuclAT_17 | - | Antitoxin |
- | 1253552..1253617 | + | 66 | NuclAT_22 | - | Antitoxin |
- | 1253552..1253617 | + | 66 | NuclAT_22 | - | Antitoxin |
- | 1253552..1253617 | + | 66 | NuclAT_22 | - | Antitoxin |
- | 1253552..1253617 | + | 66 | NuclAT_22 | - | Antitoxin |
FNZ21_RS05915 | 1253979..1255250 | + | 1272 | WP_001301684.1 | amino acid permease | - |
FNZ21_RS05920 | 1255280..1256284 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
FNZ21_RS05925 | 1256281..1257264 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
FNZ21_RS05930 | 1257275..1258177 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T128816 WP_001295224.1 NZ_CP041623:c1253503-1253396 [Escherichia coli O157:H7]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T128816 NZ_CP041623:c1253503-1253396 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT128816 NZ_CP041623:1253552-1253617 [Escherichia coli O157:H7]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|