Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 19136..19400 | Replicon | plasmid pC32_2 |
Accession | NZ_CP041621 | ||
Organism | Shigella flexneri strain C32 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Y6M3 |
Locus tag | FNL95_RS25090 | Protein ID | WP_001331364.1 |
Coordinates | 19136..19288 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 19343..19400 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FNL95_RS25070 | 14413..16581 | + | 2169 | WP_000698357.1 | DotA/TraY family protein | - |
FNL95_RS25075 | 16655..17305 | + | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
FNL95_RS25080 | 17377..17586 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
FNL95_RS25745 | 17978..18154 | + | 177 | WP_001054898.1 | hypothetical protein | - |
FNL95_RS25085 | 18813..19064 | + | 252 | WP_001291964.1 | hypothetical protein | - |
FNL95_RS25090 | 19136..19288 | - | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
- | 19343..19400 | + | 58 | NuclAT_0 | - | Antitoxin |
- | 19343..19400 | + | 58 | NuclAT_0 | - | Antitoxin |
- | 19343..19400 | + | 58 | NuclAT_0 | - | Antitoxin |
- | 19343..19400 | + | 58 | NuclAT_0 | - | Antitoxin |
- | 19641..19696 | + | 56 | NuclAT_1 | - | - |
- | 19641..19696 | + | 56 | NuclAT_1 | - | - |
- | 19641..19696 | + | 56 | NuclAT_1 | - | - |
- | 19641..19696 | + | 56 | NuclAT_1 | - | - |
FNL95_RS25095 | 19857..20843 | + | 987 | WP_001257838.1 | hypothetical protein | - |
FNL95_RS25100 | 21061..22269 | + | 1209 | WP_154832363.1 | IncI1-type conjugal transfer protein TrbA | - |
FNL95_RS25105 | 22288..23358 | + | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..88076 | 88076 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T128800 WP_001331364.1 NZ_CP041621:c19288-19136 [Shigella flexneri]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T128800 NZ_CP041621:c19288-19136 [Shigella flexneri]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 58 bp
>AT128800 NZ_CP041621:19343-19400 [Shigella flexneri]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|