Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 14751..15021 | Replicon | plasmid pYPE12-106k |
| Accession | NZ_CP041439 | ||
| Organism | Escherichia coli strain YPE12 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | FNP80_RS00125 | Protein ID | WP_001312861.1 |
| Coordinates | 14863..15021 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 14751..14814 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FNP80_RS00100 | 10465..10992 | + | 528 | WP_151140338.1 | single-stranded DNA-binding protein | - |
| FNP80_RS00105 | 11050..11282 | + | 233 | Protein_13 | DUF905 family protein | - |
| FNP80_RS00110 | 11343..13364 | + | 2022 | Protein_14 | ParB/RepB/Spo0J family partition protein | - |
| FNP80_RS00115 | 13433..13867 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| FNP80_RS00120 | 13864..14583 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 14595..14819 | + | 225 | NuclAT_0 | - | - |
| - | 14595..14819 | + | 225 | NuclAT_0 | - | - |
| - | 14595..14819 | + | 225 | NuclAT_0 | - | - |
| - | 14595..14819 | + | 225 | NuclAT_0 | - | - |
| FNP80_RS25330 | 14604..14783 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 14751..14814 | - | 64 | - | - | Antitoxin |
| FNP80_RS00125 | 14863..15021 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| FNP80_RS25335 | 15259..15636 | - | 378 | Protein_19 | hypothetical protein | - |
| FNP80_RS00145 | 15936..16232 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| FNP80_RS00150 | 16343..17164 | + | 822 | WP_151140339.1 | DUF945 domain-containing protein | - |
| FNP80_RS00155 | 17461..18108 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| FNP80_RS00160 | 18385..18768 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
| FNP80_RS00165 | 18959..19645 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| FNP80_RS00170 | 19739..19966 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | floR / dfrA14 / ant(3'')-Ia / blaOXA-10 / cmlA1 / ARR-3 / blaTEM-1B / rmtB | - | 1..106630 | 106630 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T128609 WP_001312861.1 NZ_CP041439:14863-15021 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T128609 NZ_CP041439:14863-15021 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT128609 NZ_CP041439:c14814-14751 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|