Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2737570..2737790 Replicon chromosome
Accession NZ_CP041435
Organism Escherichia coli strain STEC309

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag FNE81_RS13250 Protein ID WP_000170965.1
Coordinates 2737683..2737790 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2737570..2737636 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FNE81_RS13225 2732849..2734243 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
FNE81_RS13230 2734428..2734781 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
FNE81_RS13235 2734825..2735520 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
FNE81_RS13240 2735678..2735908 - 231 WP_001146442.1 putative cation transport regulator ChaB -
FNE81_RS13245 2736178..2737278 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2737570..2737636 - 67 - - Antitoxin
FNE81_RS13250 2737683..2737790 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2738103..2738166 - 64 NuclAT_34 - -
- 2738103..2738166 - 64 NuclAT_34 - -
- 2738103..2738166 - 64 NuclAT_34 - -
- 2738103..2738166 - 64 NuclAT_34 - -
- 2738103..2738166 - 64 NuclAT_36 - -
- 2738103..2738166 - 64 NuclAT_36 - -
- 2738103..2738166 - 64 NuclAT_36 - -
- 2738103..2738166 - 64 NuclAT_36 - -
- 2738103..2738166 - 64 NuclAT_38 - -
- 2738103..2738166 - 64 NuclAT_38 - -
- 2738103..2738166 - 64 NuclAT_38 - -
- 2738103..2738166 - 64 NuclAT_38 - -
- 2738103..2738166 - 64 NuclAT_40 - -
- 2738103..2738166 - 64 NuclAT_40 - -
- 2738103..2738166 - 64 NuclAT_40 - -
- 2738103..2738166 - 64 NuclAT_40 - -
- 2738103..2738166 - 64 NuclAT_42 - -
- 2738103..2738166 - 64 NuclAT_42 - -
- 2738103..2738166 - 64 NuclAT_42 - -
- 2738103..2738166 - 64 NuclAT_42 - -
- 2738103..2738166 - 64 NuclAT_44 - -
- 2738103..2738166 - 64 NuclAT_44 - -
- 2738103..2738166 - 64 NuclAT_44 - -
- 2738103..2738166 - 64 NuclAT_44 - -
- 2738104..2738166 - 63 NuclAT_46 - -
- 2738104..2738166 - 63 NuclAT_46 - -
- 2738104..2738166 - 63 NuclAT_46 - -
- 2738104..2738166 - 63 NuclAT_46 - -
- 2738104..2738166 - 63 NuclAT_49 - -
- 2738104..2738166 - 63 NuclAT_49 - -
- 2738104..2738166 - 63 NuclAT_49 - -
- 2738104..2738166 - 63 NuclAT_49 - -
- 2738105..2738166 - 62 NuclAT_16 - -
- 2738105..2738166 - 62 NuclAT_16 - -
- 2738105..2738166 - 62 NuclAT_16 - -
- 2738105..2738166 - 62 NuclAT_16 - -
- 2738105..2738166 - 62 NuclAT_19 - -
- 2738105..2738166 - 62 NuclAT_19 - -
- 2738105..2738166 - 62 NuclAT_19 - -
- 2738105..2738166 - 62 NuclAT_19 - -
- 2738105..2738166 - 62 NuclAT_22 - -
- 2738105..2738166 - 62 NuclAT_22 - -
- 2738105..2738166 - 62 NuclAT_22 - -
- 2738105..2738166 - 62 NuclAT_22 - -
- 2738105..2738166 - 62 NuclAT_25 - -
- 2738105..2738166 - 62 NuclAT_25 - -
- 2738105..2738166 - 62 NuclAT_25 - -
- 2738105..2738166 - 62 NuclAT_25 - -
- 2738105..2738166 - 62 NuclAT_28 - -
- 2738105..2738166 - 62 NuclAT_28 - -
- 2738105..2738166 - 62 NuclAT_28 - -
- 2738105..2738166 - 62 NuclAT_28 - -
- 2738105..2738166 - 62 NuclAT_31 - -
- 2738105..2738166 - 62 NuclAT_31 - -
- 2738105..2738166 - 62 NuclAT_31 - -
- 2738105..2738166 - 62 NuclAT_31 - -
FNE81_RS13255 2738219..2738326 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2738640..2738706 - 67 NuclAT_45 - -
- 2738640..2738706 - 67 NuclAT_45 - -
- 2738640..2738706 - 67 NuclAT_45 - -
- 2738640..2738706 - 67 NuclAT_45 - -
- 2738640..2738706 - 67 NuclAT_48 - -
- 2738640..2738706 - 67 NuclAT_48 - -
- 2738640..2738706 - 67 NuclAT_48 - -
- 2738640..2738706 - 67 NuclAT_48 - -
- 2738641..2738704 - 64 NuclAT_17 - -
- 2738641..2738704 - 64 NuclAT_17 - -
- 2738641..2738704 - 64 NuclAT_17 - -
- 2738641..2738704 - 64 NuclAT_17 - -
- 2738641..2738704 - 64 NuclAT_20 - -
- 2738641..2738704 - 64 NuclAT_20 - -
- 2738641..2738704 - 64 NuclAT_20 - -
- 2738641..2738704 - 64 NuclAT_20 - -
- 2738641..2738704 - 64 NuclAT_23 - -
- 2738641..2738704 - 64 NuclAT_23 - -
- 2738641..2738704 - 64 NuclAT_23 - -
- 2738641..2738704 - 64 NuclAT_23 - -
- 2738641..2738704 - 64 NuclAT_26 - -
- 2738641..2738704 - 64 NuclAT_26 - -
- 2738641..2738704 - 64 NuclAT_26 - -
- 2738641..2738704 - 64 NuclAT_26 - -
- 2738641..2738704 - 64 NuclAT_29 - -
- 2738641..2738704 - 64 NuclAT_29 - -
- 2738641..2738704 - 64 NuclAT_29 - -
- 2738641..2738704 - 64 NuclAT_29 - -
- 2738641..2738704 - 64 NuclAT_32 - -
- 2738641..2738704 - 64 NuclAT_32 - -
- 2738641..2738704 - 64 NuclAT_32 - -
- 2738641..2738704 - 64 NuclAT_32 - -
FNE81_RS13260 2738754..2738861 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
FNE81_RS13265 2739010..2739864 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
FNE81_RS13270 2739900..2740709 - 810 WP_001257044.1 invasion regulator SirB1 -
FNE81_RS13275 2740713..2741105 - 393 WP_000200378.1 invasion regulator SirB2 -
FNE81_RS13280 2741102..2741935 - 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T128573 WP_000170965.1 NZ_CP041435:2737683-2737790 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T128573 NZ_CP041435:2737683-2737790 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT128573 NZ_CP041435:c2737636-2737570 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References