Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 3901564..3901785 Replicon chromosome
Accession NZ_CP041429
Organism Escherichia coli strain STEC367

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag FNE84_RS18920 Protein ID WP_000170954.1
Coordinates 3901564..3901671 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 3901719..3901785 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FNE84_RS18895 3897408..3898490 + 1083 WP_000804726.1 peptide chain release factor 1 -
FNE84_RS18900 3898490..3899323 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
FNE84_RS18905 3899320..3899712 + 393 WP_000200378.1 invasion regulator SirB2 -
FNE84_RS18910 3899716..3900525 + 810 WP_001257044.1 invasion regulator SirB1 -
FNE84_RS18915 3900561..3901415 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
FNE84_RS18920 3901564..3901671 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 3901719..3901785 + 67 NuclAT_26 - Antitoxin
- 3901719..3901785 + 67 NuclAT_26 - Antitoxin
- 3901719..3901785 + 67 NuclAT_26 - Antitoxin
- 3901719..3901785 + 67 NuclAT_26 - Antitoxin
- 3901719..3901785 + 67 NuclAT_28 - Antitoxin
- 3901719..3901785 + 67 NuclAT_28 - Antitoxin
- 3901719..3901785 + 67 NuclAT_28 - Antitoxin
- 3901719..3901785 + 67 NuclAT_28 - Antitoxin
- 3901719..3901785 + 67 NuclAT_30 - Antitoxin
- 3901719..3901785 + 67 NuclAT_30 - Antitoxin
- 3901719..3901785 + 67 NuclAT_30 - Antitoxin
- 3901719..3901785 + 67 NuclAT_30 - Antitoxin
- 3901719..3901785 + 67 NuclAT_32 - Antitoxin
- 3901719..3901785 + 67 NuclAT_32 - Antitoxin
- 3901719..3901785 + 67 NuclAT_32 - Antitoxin
- 3901719..3901785 + 67 NuclAT_32 - Antitoxin
- 3901719..3901785 + 67 NuclAT_34 - Antitoxin
- 3901719..3901785 + 67 NuclAT_34 - Antitoxin
- 3901719..3901785 + 67 NuclAT_34 - Antitoxin
- 3901719..3901785 + 67 NuclAT_34 - Antitoxin
- 3901719..3901785 + 67 NuclAT_36 - Antitoxin
- 3901719..3901785 + 67 NuclAT_36 - Antitoxin
- 3901719..3901785 + 67 NuclAT_36 - Antitoxin
- 3901719..3901785 + 67 NuclAT_36 - Antitoxin
- 3901721..3901784 + 64 NuclAT_39 - -
- 3901721..3901784 + 64 NuclAT_39 - -
- 3901721..3901784 + 64 NuclAT_39 - -
- 3901721..3901784 + 64 NuclAT_39 - -
- 3901721..3901784 + 64 NuclAT_41 - -
- 3901721..3901784 + 64 NuclAT_41 - -
- 3901721..3901784 + 64 NuclAT_41 - -
- 3901721..3901784 + 64 NuclAT_41 - -
FNE84_RS18925 3902099..3902206 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 3902259..3902320 + 62 NuclAT_38 - -
- 3902259..3902320 + 62 NuclAT_38 - -
- 3902259..3902320 + 62 NuclAT_38 - -
- 3902259..3902320 + 62 NuclAT_38 - -
- 3902259..3902320 + 62 NuclAT_40 - -
- 3902259..3902320 + 62 NuclAT_40 - -
- 3902259..3902320 + 62 NuclAT_40 - -
- 3902259..3902320 + 62 NuclAT_40 - -
- 3902259..3902321 + 63 NuclAT_27 - -
- 3902259..3902321 + 63 NuclAT_27 - -
- 3902259..3902321 + 63 NuclAT_27 - -
- 3902259..3902321 + 63 NuclAT_27 - -
- 3902259..3902321 + 63 NuclAT_29 - -
- 3902259..3902321 + 63 NuclAT_29 - -
- 3902259..3902321 + 63 NuclAT_29 - -
- 3902259..3902321 + 63 NuclAT_29 - -
- 3902259..3902321 + 63 NuclAT_31 - -
- 3902259..3902321 + 63 NuclAT_31 - -
- 3902259..3902321 + 63 NuclAT_31 - -
- 3902259..3902321 + 63 NuclAT_31 - -
- 3902259..3902321 + 63 NuclAT_33 - -
- 3902259..3902321 + 63 NuclAT_33 - -
- 3902259..3902321 + 63 NuclAT_33 - -
- 3902259..3902321 + 63 NuclAT_33 - -
- 3902259..3902321 + 63 NuclAT_35 - -
- 3902259..3902321 + 63 NuclAT_35 - -
- 3902259..3902321 + 63 NuclAT_35 - -
- 3902259..3902321 + 63 NuclAT_35 - -
- 3902259..3902321 + 63 NuclAT_37 - -
- 3902259..3902321 + 63 NuclAT_37 - -
- 3902259..3902321 + 63 NuclAT_37 - -
- 3902259..3902321 + 63 NuclAT_37 - -
- 3902259..3902322 + 64 NuclAT_15 - -
- 3902259..3902322 + 64 NuclAT_15 - -
- 3902259..3902322 + 64 NuclAT_15 - -
- 3902259..3902322 + 64 NuclAT_15 - -
- 3902259..3902322 + 64 NuclAT_17 - -
- 3902259..3902322 + 64 NuclAT_17 - -
- 3902259..3902322 + 64 NuclAT_17 - -
- 3902259..3902322 + 64 NuclAT_17 - -
- 3902259..3902322 + 64 NuclAT_19 - -
- 3902259..3902322 + 64 NuclAT_19 - -
- 3902259..3902322 + 64 NuclAT_19 - -
- 3902259..3902322 + 64 NuclAT_19 - -
- 3902259..3902322 + 64 NuclAT_21 - -
- 3902259..3902322 + 64 NuclAT_21 - -
- 3902259..3902322 + 64 NuclAT_21 - -
- 3902259..3902322 + 64 NuclAT_21 - -
- 3902259..3902322 + 64 NuclAT_23 - -
- 3902259..3902322 + 64 NuclAT_23 - -
- 3902259..3902322 + 64 NuclAT_23 - -
- 3902259..3902322 + 64 NuclAT_23 - -
- 3902259..3902322 + 64 NuclAT_25 - -
- 3902259..3902322 + 64 NuclAT_25 - -
- 3902259..3902322 + 64 NuclAT_25 - -
- 3902259..3902322 + 64 NuclAT_25 - -
FNE84_RS18930 3902635..3902742 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 3902790..3902857 + 68 NuclAT_14 - -
- 3902790..3902857 + 68 NuclAT_14 - -
- 3902790..3902857 + 68 NuclAT_14 - -
- 3902790..3902857 + 68 NuclAT_14 - -
- 3902790..3902857 + 68 NuclAT_16 - -
- 3902790..3902857 + 68 NuclAT_16 - -
- 3902790..3902857 + 68 NuclAT_16 - -
- 3902790..3902857 + 68 NuclAT_16 - -
- 3902790..3902857 + 68 NuclAT_18 - -
- 3902790..3902857 + 68 NuclAT_18 - -
- 3902790..3902857 + 68 NuclAT_18 - -
- 3902790..3902857 + 68 NuclAT_18 - -
- 3902790..3902857 + 68 NuclAT_20 - -
- 3902790..3902857 + 68 NuclAT_20 - -
- 3902790..3902857 + 68 NuclAT_20 - -
- 3902790..3902857 + 68 NuclAT_20 - -
- 3902790..3902857 + 68 NuclAT_22 - -
- 3902790..3902857 + 68 NuclAT_22 - -
- 3902790..3902857 + 68 NuclAT_22 - -
- 3902790..3902857 + 68 NuclAT_22 - -
- 3902790..3902857 + 68 NuclAT_24 - -
- 3902790..3902857 + 68 NuclAT_24 - -
- 3902790..3902857 + 68 NuclAT_24 - -
- 3902790..3902857 + 68 NuclAT_24 - -
FNE84_RS18935 3903147..3904247 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
FNE84_RS18940 3904517..3904747 + 231 WP_001146442.1 putative cation transport regulator ChaB -
FNE84_RS18945 3904905..3905600 + 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
FNE84_RS18950 3905644..3905997 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T128452 WP_000170954.1 NZ_CP041429:c3901671-3901564 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T128452 NZ_CP041429:c3901671-3901564 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT128452 NZ_CP041429:3901719-3901785 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References