Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 64292..64562 | Replicon | plasmid pSTEC409_2 |
Accession | NZ_CP041424 | ||
Organism | Escherichia coli strain STEC409 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | FNE86_RS23760 | Protein ID | WP_001312861.1 |
Coordinates | 64404..64562 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 64292..64355 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FNE86_RS23975 | 59432..59587 | + | 156 | WP_170938106.1 | hypothetical protein | - |
FNE86_RS23980 | 59580..59915 | + | 336 | WP_077763704.1 | hypothetical protein | - |
FNE86_RS23985 | 59828..60034 | + | 207 | WP_000275853.1 | hypothetical protein | - |
FNE86_RS23730 | 60060..60599 | + | 540 | WP_161620593.1 | single-stranded DNA-binding protein | - |
FNE86_RS23735 | 60662..60895 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
FNE86_RS23740 | 60961..62919 | + | 1959 | WP_161620594.1 | ParB/RepB/Spo0J family partition protein | - |
FNE86_RS23745 | 62974..63408 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
FNE86_RS23750 | 63405..64124 | + | 720 | WP_161620595.1 | plasmid SOS inhibition protein A | - |
FNE86_RS23755 | 64136..64324 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 64136..64360 | + | 225 | NuclAT_0 | - | - |
- | 64136..64360 | + | 225 | NuclAT_0 | - | - |
- | 64136..64360 | + | 225 | NuclAT_0 | - | - |
- | 64136..64360 | + | 225 | NuclAT_0 | - | - |
- | 64292..64355 | - | 64 | - | - | Antitoxin |
FNE86_RS23760 | 64404..64562 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
FNE86_RS23990 | 64857..65012 | + | 156 | WP_170938106.1 | hypothetical protein | - |
FNE86_RS23770 | 65573..65770 | + | 198 | WP_052318758.1 | hypothetical protein | - |
FNE86_RS23775 | 65888..66709 | + | 822 | WP_074014913.1 | DUF945 domain-containing protein | - |
FNE86_RS23780 | 67006..67608 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
FNE86_RS23785 | 67929..68312 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
FNE86_RS23790 | 68499..69188 | + | 690 | WP_021532962.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..81110 | 81110 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T128406 WP_001312861.1 NZ_CP041424:64404-64562 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T128406 NZ_CP041424:64404-64562 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT128406 NZ_CP041424:c64355-64292 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|