Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1191492..1191738 | Replicon | chromosome |
Accession | NZ_CP041416 | ||
Organism | Escherichia coli strain STEC711 |
Toxin (Protein)
Gene name | hokX | Uniprot ID | S1PD89 |
Locus tag | FNE87_RS05650 | Protein ID | WP_000956458.1 |
Coordinates | 1191586..1191738 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokX | ||
Locus tag | - | ||
Coordinates | 1191492..1191546 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FNE87_RS05635 | 1187002..1188801 | + | 1800 | WP_000211954.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
FNE87_RS05640 | 1188801..1190513 | + | 1713 | WP_001290706.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
FNE87_RS05645 | 1190587..1191321 | + | 735 | WP_000039843.1 | phosphoadenosine phosphosulfate reductase | - |
- | 1191492..1191546 | - | 55 | - | - | Antitoxin |
FNE87_RS05650 | 1191586..1191738 | + | 153 | WP_000956458.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
FNE87_RS05655 | 1191932..1194631 | + | 2700 | WP_050864154.1 | CRISPR-associated helicase/endonuclease Cas3 | - |
FNE87_RS05660 | 1194729..1196291 | + | 1563 | WP_001084104.1 | type I-E CRISPR-associated protein Cse1/CasA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5558.77 Da Isoelectric Point: 7.6757
>T128353 WP_000956458.1 NZ_CP041416:1191586-1191738 [Escherichia coli]
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
>T128353 NZ_CP041416:1191586-1191738 [Escherichia coli]
ATGCTGACAAAATATGCCCTTGTGGCAATCATCGTACTGTGTTGTACAGTACTGGGATTCACGCTGATGGTAGGTGACTC
GTTGTGTGAGTTGAGTATCAGAGAACGTGGTATGGAGTTTAAGGCAGTTCTCGCTTACGAATCGAAGAAGTAG
ATGCTGACAAAATATGCCCTTGTGGCAATCATCGTACTGTGTTGTACAGTACTGGGATTCACGCTGATGGTAGGTGACTC
GTTGTGTGAGTTGAGTATCAGAGAACGTGGTATGGAGTTTAAGGCAGTTCTCGCTTACGAATCGAAGAAGTAG
Antitoxin
Download Length: 55 bp
>AT128353 NZ_CP041416:c1191546-1191492 [Escherichia coli]
GTTTGGGTTCGAACGTAAGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
GTTTGGGTTCGAACGTAAGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|