Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 178602..178859 | Replicon | chromosome |
Accession | NZ_CP041416 | ||
Organism | Escherichia coli strain STEC711 |
Toxin (Protein)
Gene name | hokA | Uniprot ID | V0YDF1 |
Locus tag | FNE87_RS00820 | Protein ID | WP_001135738.1 |
Coordinates | 178707..178859 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokA | ||
Locus tag | - | ||
Coordinates | 178602..178656 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FNE87_RS00800 | 173827..174822 | - | 996 | WP_001182653.1 | O-acetyltransferase WecH | - |
FNE87_RS00805 | 174997..175296 | + | 300 | WP_000980104.1 | membrane protein | - |
FNE87_RS00810 | 175391..176302 | + | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
FNE87_RS00815 | 176312..178381 | + | 2070 | WP_001291774.1 | glycine--tRNA ligase subunit beta | - |
- | 178602..178656 | - | 55 | - | - | Antitoxin |
FNE87_RS00820 | 178707..178859 | + | 153 | WP_001135738.1 | type I toxin-antitoxin system toxin HokA | Toxin |
FNE87_RS00825 | 179047..179259 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
FNE87_RS00830 | 179540..179830 | - | 291 | WP_000455798.1 | HTH-type transcriptional regulator | - |
FNE87_RS00835 | 180264..180974 | + | 711 | WP_000190517.1 | DUF3053 domain-containing protein | - |
FNE87_RS00840 | 181024..181998 | - | 975 | WP_000805027.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
FNE87_RS00845 | 182102..182761 | - | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5912.14 Da Isoelectric Point: 7.7173
>T128346 WP_001135738.1 NZ_CP041416:178707-178859 [Escherichia coli]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
Download Length: 153 bp
>T128346 NZ_CP041416:178707-178859 [Escherichia coli]
ATGCCGCAGAAATATAGATTACTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCATTTTTAGCCTGCAATTTAAAAGAGTAA
ATGCCGCAGAAATATAGATTACTTTCTTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGGGAGTTATGAGCTGGCGGCATTTTTAGCCTGCAATTTAAAAGAGTAA
Antitoxin
Download Length: 55 bp
>AT128346 NZ_CP041416:c178656-178602 [Escherichia coli]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|