Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 62360..62629 | Replicon | plasmid pSTEC719_4 |
Accession | NZ_CP041415 | ||
Organism | Escherichia coli strain STEC719 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | FNE88_RS25635 | Protein ID | WP_001312861.1 |
Coordinates | 62471..62629 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 62360..62425 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FNE88_RS25605 | 58127..58666 | + | 540 | WP_000290791.1 | single-stranded DNA-binding protein | - |
FNE88_RS25610 | 58729..58962 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
FNE88_RS25615 | 59028..60986 | + | 1959 | WP_023148339.1 | ParB/RepB/Spo0J family partition protein | - |
FNE88_RS25620 | 61041..61475 | + | 435 | WP_000845934.1 | conjugation system SOS inhibitor PsiB | - |
FNE88_RS25625 | 61472..62191 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
FNE88_RS25630 | 62203..62391 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 62203..62427 | + | 225 | NuclAT_0 | - | - |
- | 62203..62427 | + | 225 | NuclAT_0 | - | - |
- | 62203..62427 | + | 225 | NuclAT_0 | - | - |
- | 62203..62427 | + | 225 | NuclAT_0 | - | - |
- | 62360..62425 | + | 66 | - | - | Antitoxin |
FNE88_RS25635 | 62471..62629 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
FNE88_RS25645 | 63551..63838 | + | 288 | WP_161622521.1 | hypothetical protein | - |
FNE88_RS25650 | 63956..64777 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
FNE88_RS25655 | 65074..65664 | - | 591 | WP_165899088.1 | transglycosylase SLT domain-containing protein | - |
FNE88_RS25660 | 66015..66398 | + | 384 | WP_001063021.1 | relaxosome protein TraM | - |
FNE88_RS25665 | 66589..67236 | + | 648 | WP_000332519.1 | conjugal transfer transcriptional regulator TraJ | - |
FNE88_RS25670 | 67372..67587 | + | 216 | WP_000086381.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..85426 | 85426 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T128343 WP_001312861.1 NZ_CP041415:62471-62629 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T128343 NZ_CP041415:62471-62629 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT128343 NZ_CP041415:62360-62425 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|