Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 47937..48207 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP041358 | ||
| Organism | Escherichia coli strain U1 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | E3Z32_RS00360 | Protein ID | WP_001312861.1 |
| Coordinates | 48049..48207 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 47937..48000 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E3Z32_RS00335 | 43707..44234 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| E3Z32_RS00340 | 44292..44525 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| E3Z32_RS00345 | 44586..46550 | + | 1965 | WP_001537566.1 | ParB/RepB/Spo0J family partition protein | - |
| E3Z32_RS00350 | 46619..47053 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| E3Z32_RS00355 | 47050..47769 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 47781..48005 | + | 225 | NuclAT_0 | - | - |
| - | 47781..48005 | + | 225 | NuclAT_0 | - | - |
| - | 47781..48005 | + | 225 | NuclAT_0 | - | - |
| - | 47781..48005 | + | 225 | NuclAT_0 | - | - |
| E3Z32_RS27135 | 47790..47969 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 47937..48000 | - | 64 | - | - | Antitoxin |
| E3Z32_RS00360 | 48049..48207 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| E3Z32_RS00365 | 48508..48712 | - | 205 | Protein_59 | pilus protein | - |
| E3Z32_RS00375 | 49104..49400 | + | 297 | WP_001545326.1 | hypothetical protein | - |
| E3Z32_RS00380 | 49510..50331 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
| E3Z32_RS00385 | 50628..51230 | - | 603 | Protein_62 | transglycosylase SLT domain-containing protein | - |
| E3Z32_RS00390 | 51551..51934 | + | 384 | WP_001151538.1 | relaxosome protein TraM | - |
| E3Z32_RS00395 | 52121..52810 | + | 690 | WP_000283387.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | senB | 1..130003 | 130003 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T128163 WP_001312861.1 NZ_CP041358:48049-48207 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T128163 NZ_CP041358:48049-48207 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT128163 NZ_CP041358:c48000-47937 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|