Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 341149..341344 | Replicon | chromosome |
Accession | NZ_CP041344 | ||
Organism | Enterococcus faecalis strain DM01 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | FLL49_RS14135 | Protein ID | WP_015543884.1 |
Coordinates | 341249..341344 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 341149..341214 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FLL49_RS01860 | 336780..338522 | + | 1743 | WP_016626079.1 | PTS transporter subunit EIIC | - |
FLL49_RS01865 | 338513..340546 | + | 2034 | WP_016626080.1 | transcription antiterminator | - |
FLL49_RS01870 | 340557..340991 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
- | 341149..341214 | + | 66 | NuclAT_14 | - | Antitoxin |
FLL49_RS14135 | 341249..341344 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
FLL49_RS01880 | 341590..343362 | + | 1773 | WP_010821364.1 | PTS mannitol transporter subunit IICBA | - |
FLL49_RS01885 | 343377..343814 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
FLL49_RS01890 | 343829..344983 | + | 1155 | WP_141893142.1 | mannitol-1-phosphate 5-dehydrogenase | - |
FLL49_RS01895 | 345051..346166 | - | 1116 | WP_016626083.1 | FAD-binding oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T128092 WP_015543884.1 NZ_CP041344:c341344-341249 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T128092 NZ_CP041344:c341344-341249 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGCTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGCTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 66 bp
>AT128092 NZ_CP041344:341149-341214 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|