Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 271865..272087 | Replicon | chromosome |
Accession | NZ_CP041304 | ||
Organism | Escherichia coli strain MSHS 133 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | FK544_RS25640 | Protein ID | WP_001295224.1 |
Coordinates | 271980..272087 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 271865..271931 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FK544_RS02345 | 267253..268236 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
FK544_RS02350 | 268233..269237 | + | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
FK544_RS02355 | 269267..270538 | - | 1272 | WP_001318103.1 | amino acid permease | - |
FK544_RS02365 | 271014..271121 | + | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
FK544_RS02375 | 271497..271604 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 271865..271931 | - | 67 | - | - | Antitoxin |
FK544_RS25640 | 271980..272087 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
FK544_RS02395 | 272463..272570 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
FK544_RS02400 | 272657..274336 | - | 1680 | WP_001562264.1 | cellulose biosynthesis protein BcsG | - |
FK544_RS02405 | 274333..274524 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
FK544_RS02410 | 274521..276092 | - | 1572 | WP_141841192.1 | cellulose biosynthesis protein BcsE | - |
FK544_RS02415 | 276365..276553 | + | 189 | WP_001063315.1 | YhjR family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T128017 WP_001295224.1 NZ_CP041304:271980-272087 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T128017 NZ_CP041304:271980-272087 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT128017 NZ_CP041304:c271931-271865 [Escherichia coli]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|