Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 951953..952133 | Replicon | chromosome |
Accession | NZ_CP041037 | ||
Organism | Staphylococcus aureus strain NP66 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | FIV54_RS05045 | Protein ID | WP_001801861.1 |
Coordinates | 952038..952133 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 951953..952010 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FIV54_RS05015 | 948304..949422 | + | 1119 | WP_000072558.1 | restriction endonuclease subunit S | - |
FIV54_RS05020 | 950070..950513 | + | 444 | WP_000742594.1 | DUF1433 domain-containing protein | - |
FIV54_RS05025 | 950723..951070 | + | 348 | WP_001566695.1 | DUF1433 domain-containing protein | - |
FIV54_RS05030 | 951092..951466 | + | 375 | WP_145326054.1 | DUF1433 domain-containing protein | - |
FIV54_RS05035 | 951654..951836 | + | 183 | Protein_921 | transposase | - |
FIV54_RS05040 | 951814..951915 | - | 102 | WP_001791232.1 | hypothetical protein | - |
- | 951953..952010 | + | 58 | - | - | Antitoxin |
FIV54_RS05045 | 952038..952133 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
FIV54_RS05055 | 952584..953030 | + | 447 | WP_000747802.1 | DUF1433 domain-containing protein | - |
FIV54_RS05060 | 953715..954098 | + | 384 | WP_000070811.1 | hypothetical protein | - |
FIV54_RS05065 | 954109..954285 | + | 177 | WP_000375476.1 | hypothetical protein | - |
FIV54_RS05075 | 954656..955213 | + | 558 | WP_000864138.1 | ImmA/IrrE family metallo-endopeptidase | - |
FIV54_RS05080 | 955411..955983 | - | 573 | WP_000414212.1 | hypothetical protein | - |
FIV54_RS05085 | 956084..956425 | - | 342 | WP_000627548.1 | DUF3969 family protein | - |
FIV54_RS05090 | 956466..957092 | - | 627 | WP_000669019.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | hlgA / lukD | 933265..958858 | 25593 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T127498 WP_001801861.1 NZ_CP041037:c952133-952038 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T127498 NZ_CP041037:c952133-952038 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT127498 NZ_CP041037:951953-952010 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|