Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 2763931..2764125 | Replicon | chromosome |
Accession | NZ_CP041012 | ||
Organism | Enterococcus faecalis strain FDAARGOS_611 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | FIU23_RS14525 | Protein ID | WP_015543884.1 |
Coordinates | 2763931..2764026 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 2764061..2764125 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FIU23_RS14045 | 2759108..2760223 | + | 1116 | WP_002364956.1 | FAD-binding oxidoreductase | - |
FIU23_RS14050 | 2760292..2761446 | - | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
FIU23_RS14055 | 2761461..2761898 | - | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
FIU23_RS14060 | 2761913..2763685 | - | 1773 | WP_002391520.1 | PTS mannitol transporter subunit IICBA | - |
FIU23_RS14525 | 2763931..2764026 | + | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2764061..2764125 | - | 65 | NuclAT_8 | - | Antitoxin |
FIU23_RS14070 | 2764296..2764730 | - | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
FIU23_RS14075 | 2764741..2766774 | - | 2034 | WP_002355275.1 | transcription antiterminator | - |
FIU23_RS14080 | 2766765..2768507 | - | 1743 | WP_002391519.1 | PTS transporter subunit EIIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T127419 WP_015543884.1 NZ_CP041012:2763931-2764026 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T127419 NZ_CP041012:2763931-2764026 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT127419 NZ_CP041012:c2764125-2764061 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|