Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2623774..2623956 | Replicon | chromosome |
Accession | NZ_CP040998 | ||
Organism | Staphylococcus aureus strain FDAARGOS_773 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | FIU14_RS13350 | Protein ID | WP_001801861.1 |
Coordinates | 2623861..2623956 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2623774..2623833 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FIU14_RS13335 | 2622912..2623289 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
FIU14_RS13340 | 2623483..2623659 | + | 177 | Protein_2524 | transposase | - |
FIU14_RS13345 | 2623637..2623738 | - | 102 | WP_001791893.1 | hypothetical protein | - |
- | 2623774..2623833 | + | 60 | - | - | Antitoxin |
FIU14_RS13350 | 2623861..2623956 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
FIU14_RS13360 | 2624159..2624302 | + | 144 | WP_001549059.1 | transposase | - |
FIU14_RS13370 | 2624906..2625289 | + | 384 | WP_000070812.1 | hypothetical protein | - |
FIU14_RS13375 | 2625300..2625476 | + | 177 | WP_000375476.1 | hypothetical protein | - |
FIU14_RS13380 | 2625478..2625663 | + | 186 | WP_000809857.1 | hypothetical protein | - |
FIU14_RS13385 | 2625777..2626418 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
FIU14_RS13390 | 2626636..2627187 | - | 552 | WP_000414205.1 | hypothetical protein | - |
FIU14_RS13395 | 2627285..2627629 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
FIU14_RS13400 | 2627670..2628296 | - | 627 | WP_000669046.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2603859..2661397 | 57538 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T127351 WP_001801861.1 NZ_CP040998:c2623956-2623861 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T127351 NZ_CP040998:c2623956-2623861 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT127351 NZ_CP040998:2623774-2623833 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|