Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 19728..19992 | Replicon | plasmid p853EC4 |
| Accession | NZ_CP040923 | ||
| Organism | Escherichia coli strain FC853_EC | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | FH485_RS27635 | Protein ID | WP_001387489.1 |
| Coordinates | 19840..19992 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 19728..19788 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FH485_RS27600 | 15854..16117 | + | 264 | WP_032180564.1 | ash family protein | - |
| FH485_RS27605 | 16035..16322 | + | 288 | WP_000074855.1 | conjugal transfer protein TraA | - |
| FH485_RS27615 | 16764..17069 | + | 306 | Protein_23 | transcription termination factor NusG | - |
| FH485_RS27620 | 17083..17779 | - | 697 | Protein_24 | IS1 family transposase | - |
| FH485_RS27625 | 17835..18992 | - | 1158 | Protein_25 | IS1380-like element ISEc9 family transposase | - |
| FH485_RS27630 | 19178..19525 | - | 348 | Protein_26 | protein finQ | - |
| - | 19728..19788 | - | 61 | NuclAT_0 | - | Antitoxin |
| - | 19728..19788 | - | 61 | NuclAT_0 | - | Antitoxin |
| - | 19728..19788 | - | 61 | NuclAT_0 | - | Antitoxin |
| - | 19728..19788 | - | 61 | NuclAT_0 | - | Antitoxin |
| FH485_RS27635 | 19840..19992 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| FH485_RS27640 | 20064..20315 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| FH485_RS27645 | 20615..20911 | + | 297 | WP_011264046.1 | hypothetical protein | - |
| FH485_RS28045 | 20976..21152 | - | 177 | WP_001054897.1 | hypothetical protein | - |
| FH485_RS27650 | 21544..21753 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| FH485_RS27655 | 21978..22675 | + | 698 | Protein_32 | IS1 family transposase | - |
| FH485_RS27660 | 23128..24273 | + | 1146 | WP_039023136.1 | class C extended-spectrum beta-lactamase CMY-42 | - |
| FH485_RS27665 | 24367..24900 | + | 534 | WP_001221666.1 | lipocalin family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCMY-42 | - | 1..45224 | 45224 | |
| - | inside | IScluster/Tn | blaCMY-42 | - | 17504..24273 | 6769 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T127270 WP_001387489.1 NZ_CP040923:19840-19992 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T127270 NZ_CP040923:19840-19992 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 61 bp
>AT127270 NZ_CP040923:c19788-19728 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|