Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 10458..10727 | Replicon | plasmid p853EC3 |
| Accession | NZ_CP040922 | ||
| Organism | Escherichia coli strain FC853_EC | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | FH485_RS26630 | Protein ID | WP_001312861.1 |
| Coordinates | 10569..10727 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 10458..10523 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FH485_RS26605 | 5679..7637 | + | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
| FH485_RS26610 | 7692..8126 | + | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| FH485_RS26615 | 8123..8842 | + | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| - | 8854..8956 | + | 103 | NuclAT_1 | - | - |
| - | 8854..8956 | + | 103 | NuclAT_1 | - | - |
| - | 8854..8956 | + | 103 | NuclAT_1 | - | - |
| - | 8854..8956 | + | 103 | NuclAT_1 | - | - |
| FH485_RS26620 | 9002..10371 | + | 1370 | WP_140028060.1 | IS3-like element IS150 family transposase | - |
| - | 10398..10525 | + | 128 | NuclAT_0 | - | - |
| - | 10398..10525 | + | 128 | NuclAT_0 | - | - |
| - | 10398..10525 | + | 128 | NuclAT_0 | - | - |
| - | 10398..10525 | + | 128 | NuclAT_0 | - | - |
| - | 10458..10523 | + | 66 | - | - | Antitoxin |
| FH485_RS26630 | 10569..10727 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| FH485_RS26650 | 11504..11623 | + | 120 | WP_032165723.1 | hypothetical protein | - |
| FH485_RS26655 | 11648..11935 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| FH485_RS26660 | 12054..12875 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| FH485_RS26665 | 13172..13774 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| FH485_RS26670 | 14105..14488 | + | 384 | WP_001151566.1 | relaxosome protein TraM | - |
| FH485_RS26675 | 14622..15299 | + | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| FH485_RS26680 | 15387..15614 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aph(6)-Id / aph(3'')-Ib / mph(A) / erm(B) / tet(B) / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..143714 | 143714 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T127260 WP_001312861.1 NZ_CP040922:10569-10727 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T127260 NZ_CP040922:10569-10727 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT127260 NZ_CP040922:10458-10523 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|