Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 2671623..2671818 | Replicon | chromosome |
Accession | NZ_CP040898 | ||
Organism | Enterococcus faecalis strain HA-1 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | FHO10_RS15305 | Protein ID | WP_015543884.1 |
Coordinates | 2671623..2671718 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 2671753..2671818 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FHO10_RS13980 | 2666801..2667915 | + | 1115 | Protein_2491 | FAD-binding oxidoreductase | - |
FHO10_RS13985 | 2667984..2669138 | - | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
FHO10_RS13990 | 2669153..2669590 | - | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
FHO10_RS13995 | 2669605..2671377 | - | 1773 | WP_002391520.1 | PTS mannitol transporter subunit IICBA | - |
FHO10_RS15305 | 2671623..2671718 | + | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2671753..2671818 | - | 66 | - | - | Antitoxin |
FHO10_RS14005 | 2671976..2672410 | - | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
FHO10_RS14010 | 2672421..2674454 | - | 2034 | WP_002355275.1 | transcription antiterminator | - |
FHO10_RS14015 | 2674445..2676187 | - | 1743 | WP_002401739.1 | PTS transporter subunit EIIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T127202 WP_015543884.1 NZ_CP040898:2671623-2671718 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
>T127202 NZ_CP040898:2671623-2671718 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 66 bp
>AT127202 NZ_CP040898:c2671818-2671753 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|