Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 30916..31130 | Replicon | plasmid punnamed |
Accession | NZ_CP040897 | ||
Organism | Enterococcus faecalis strain HA-1 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | FHO10_RS00215 | Protein ID | WP_002360667.1 |
Coordinates | 30916..31026 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 31066..31130 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FHO10_RS00170 | 26195..26497 | + | 303 | WP_002367825.1 | hypothetical protein | - |
FHO10_RS00175 | 26837..27457 | + | 621 | WP_021732893.1 | recombinase family protein | - |
FHO10_RS00180 | 27474..27761 | + | 288 | WP_010708491.1 | hypothetical protein | - |
FHO10_RS00185 | 27755..27979 | + | 225 | WP_010708492.1 | hypothetical protein | - |
FHO10_RS00190 | 28040..28249 | + | 210 | WP_002387638.1 | hypothetical protein | - |
FHO10_RS00195 | 28261..28563 | + | 303 | WP_002365939.1 | hypothetical protein | - |
FHO10_RS00200 | 28990..30318 | + | 1329 | WP_021732894.1 | Y-family DNA polymerase | - |
FHO10_RS00205 | 30315..30665 | + | 351 | WP_002399364.1 | hypothetical protein | - |
FHO10_RS00215 | 30916..31026 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 31066..31130 | - | 65 | - | - | Antitoxin |
FHO10_RS00220 | 31266..31562 | + | 297 | WP_002360665.1 | replication control protein PrgN | - |
FHO10_RS00225 | 31816..32598 | + | 783 | WP_002360664.1 | ParA family protein | - |
FHO10_RS00230 | 32591..32947 | + | 357 | WP_002360663.1 | hypothetical protein | - |
FHO10_RS00235 | 33207..34214 | + | 1008 | WP_010715977.1 | replication initiator protein A | - |
FHO10_RS00240 | 34373..36010 | + | 1638 | WP_010715978.1 | peptide pheromone-binding protein TraC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | prgB/asc10 | 1..74657 | 74657 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T127191 WP_002360667.1 NZ_CP040897:30916-31026 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
>T127191 NZ_CP040897:30916-31026 [Enterococcus faecalis]
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
Antitoxin
Download Length: 65 bp
>AT127191 NZ_CP040897:c31130-31066 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|