Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2162528..2162745 | Replicon | chromosome |
Accession | NZ_CP040801 | ||
Organism | Staphylococcus aureus strain S15 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | FHD66_RS10580 | Protein ID | WP_001802298.1 |
Coordinates | 2162641..2162745 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2162528..2162583 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FHD66_RS10560 | 2158719..2159384 | - | 666 | WP_001024088.1 | SDR family oxidoreductase | - |
FHD66_RS10565 | 2159536..2159856 | + | 321 | WP_000139802.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
FHD66_RS10570 | 2159858..2160835 | + | 978 | WP_000019732.1 | CDF family zinc efflux transporter CzrB | - |
FHD66_RS10575 | 2161101..2162192 | + | 1092 | WP_000495695.1 | hypothetical protein | - |
- | 2162528..2162583 | + | 56 | - | - | Antitoxin |
FHD66_RS10580 | 2162641..2162745 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
FHD66_RS10585 | 2162906..2163389 | - | 484 | Protein_2041 | recombinase family protein | - |
FHD66_RS10590 | 2163432..2164568 | - | 1137 | Protein_2042 | SAP domain-containing protein | - |
FHD66_RS10595 | 2164857..2164949 | + | 93 | WP_031844941.1 | hypothetical protein | - |
FHD66_RS10600 | 2165644..2166501 | - | 858 | WP_000370919.1 | Cof-type HAD-IIB family hydrolase | - |
FHD66_RS10605 | 2166569..2167351 | - | 783 | WP_000908190.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T126984 WP_001802298.1 NZ_CP040801:c2162745-2162641 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T126984 NZ_CP040801:c2162745-2162641 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT126984 NZ_CP040801:2162528-2162583 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|