Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 1862507..1862806 | Replicon | chromosome |
Accession | NZ_CP040801 | ||
Organism | Staphylococcus aureus strain S15 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | FHD66_RS08815 | Protein ID | WP_011447039.1 |
Coordinates | 1862630..1862806 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1862507..1862562 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FHD66_RS08775 | 1857838..1858098 | + | 261 | WP_001791826.1 | hypothetical protein | - |
FHD66_RS08780 | 1858151..1858501 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
FHD66_RS08785 | 1859186..1859635 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
FHD66_RS08790 | 1859730..1860065 | - | 336 | Protein_1726 | SH3 domain-containing protein | - |
FHD66_RS08795 | 1860715..1861206 | - | 492 | WP_000919350.1 | staphylokinase | - |
FHD66_RS08800 | 1861397..1862152 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
FHD66_RS08805 | 1862164..1862418 | - | 255 | WP_000611512.1 | phage holin | - |
FHD66_RS08810 | 1862470..1862577 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1862499..1862638 | + | 140 | NuclAT_0 | - | - |
- | 1862499..1862638 | + | 140 | NuclAT_0 | - | - |
- | 1862499..1862638 | + | 140 | NuclAT_0 | - | - |
- | 1862499..1862638 | + | 140 | NuclAT_0 | - | - |
- | 1862507..1862562 | + | 56 | - | - | Antitoxin |
FHD66_RS08815 | 1862630..1862806 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
FHD66_RS08820 | 1862956..1863252 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
FHD66_RS08825 | 1863310..1863597 | - | 288 | WP_001040261.1 | hypothetical protein | - |
FHD66_RS08830 | 1863644..1863796 | - | 153 | WP_001153681.1 | hypothetical protein | - |
FHD66_RS08835 | 1863786..1867571 | - | 3786 | WP_189912511.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | hysA / scn / chp / sak | 1845485..1906144 | 60659 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T126978 WP_011447039.1 NZ_CP040801:c1862806-1862630 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T126978 NZ_CP040801:c1862806-1862630 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT126978 NZ_CP040801:1862507-1862562 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|