Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 58802..59054 | Replicon | plasmid p16HN-35_KPC |
| Accession | NZ_CP040713 | ||
| Organism | Klebsiella pneumoniae strain 16HN-35 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | - |
| Locus tag | FGL96_RS28905 | Protein ID | WP_286497435.1 |
| Coordinates | 58956..59054 (+) | Length | 33 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 58802..58861 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGL96_RS28870 (54145) | 54145..54360 | + | 216 | Protein_76 | type IV conjugative transfer system protein TraL | - |
| FGL96_RS28875 (54380) | 54380..54544 | + | 165 | Protein_77 | TraE/TraK family type IV conjugative transfer system protein | - |
| FGL96_RS28880 (54584) | 54584..55296 | - | 713 | Protein_78 | IS6 family transposase | - |
| FGL96_RS28885 (55537) | 55537..56283 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| FGL96_RS28890 (56338) | 56338..56898 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| FGL96_RS28895 (57030) | 57030..57230 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| FGL96_RS28900 (57616) | 57616..58213 | + | 598 | Protein_82 | PIN domain-containing protein | - |
| - (58802) | 58802..58861 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (58802) | 58802..58861 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (58802) | 58802..58861 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (58802) | 58802..58861 | - | 60 | NuclAT_0 | - | Antitoxin |
| FGL96_RS28905 (58956) | 58956..59054 | + | 99 | WP_286497435.1 | Hok/Gef family protein | Toxin |
| FGL96_RS28910 (59338) | 59338..59586 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaCTX-M-65 / blaKPC-2 | - | 1..59897 | 59897 | |
| - | flank | IS/Tn | - | - | 54967..55296 | 329 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 33 a.a. Molecular weight: 3776.42 Da Isoelectric Point: 9.2757
>T126892 WP_286497435.1 NZ_CP040713:58956-59054 [Klebsiella pneumoniae]
VFSLIFRERLCELNIHRGNTVVQVTLAYEARK
VFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 99 bp
>T126892 NZ_CP040713:58956-59054 [Klebsiella pneumoniae]
GTGTTTTCACTGATATTCAGGGAACGGTTATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGC
CTACGAAGCACGGAAGTAA
GTGTTTTCACTGATATTCAGGGAACGGTTATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGC
CTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT126892 NZ_CP040713:c58861-58802 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|