Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 36176..36602 | Replicon | plasmid p16HN-35_Vir |
Accession | NZ_CP040712 | ||
Organism | Klebsiella pneumoniae strain 16HN-35 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | FGL96_RS27175 | Protein ID | WP_001372321.1 |
Coordinates | 36176..36301 (-) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 36378..36602 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGL96_RS27135 (31214) | 31214..31441 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
FGL96_RS27140 (31535) | 31535..32221 | - | 687 | WP_000332487.1 | PAS domain-containing protein | - |
FGL96_RS27145 (32415) | 32415..32798 | - | 384 | WP_001151564.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
FGL96_RS27150 (33093) | 33093..33731 | + | 639 | WP_281440555.1 | transglycosylase SLT domain-containing protein | - |
FGL96_RS27155 (34028) | 34028..34849 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
FGL96_RS27160 (34970) | 34970..35257 | - | 288 | WP_000107537.1 | hypothetical protein | - |
FGL96_RS27165 (35555) | 35555..35728 | + | 174 | Protein_44 | hypothetical protein | - |
FGL96_RS27170 (35726) | 35726..35956 | - | 231 | WP_071587244.1 | hypothetical protein | - |
FGL96_RS27175 (36176) | 36176..36301 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
FGL96_RS27180 (36243) | 36243..36392 | - | 150 | Protein_47 | plasmid maintenance protein Mok | - |
- (36378) | 36378..36602 | - | 225 | NuclAT_0 | - | Antitoxin |
- (36378) | 36378..36602 | - | 225 | NuclAT_0 | - | Antitoxin |
- (36378) | 36378..36602 | - | 225 | NuclAT_0 | - | Antitoxin |
- (36378) | 36378..36602 | - | 225 | NuclAT_0 | - | Antitoxin |
FGL96_RS27185 (36571) | 36571..37333 | - | 763 | Protein_48 | plasmid SOS inhibition protein A | - |
FGL96_RS27190 (37330) | 37330..37764 | - | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
FGL96_RS27195 (37819) | 37819..39777 | - | 1959 | WP_032152921.1 | ParB/RepB/Spo0J family partition protein | - |
FGL96_RS27200 (39836) | 39836..40069 | - | 234 | WP_000006018.1 | DUF905 domain-containing protein | - |
FGL96_RS27205 (40125) | 40125..40652 | - | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
FGL96_RS27210 (41122) | 41122..41370 | - | 249 | WP_071606928.1 | hypothetical protein | - |
FGL96_RS27215 (41292) | 41292..41522 | - | 231 | WP_001333093.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) | iroB / iroC / iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA | 1..270854 | 270854 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T126885 WP_001372321.1 NZ_CP040712:c36301-36176 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T126885 NZ_CP040712:c36301-36176 [Klebsiella pneumoniae]
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
GTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACGAAAATCGCTGTGCGAGATTCGTTACAGAGACGG
ACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 225 bp
>AT126885 NZ_CP040712:c36602-36378 [Klebsiella pneumoniae]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|