Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1894460..1894640 | Replicon | chromosome |
Accession | NZ_CP040665 | ||
Organism | Staphylococcus aureus strain D592 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | FFX42_RS09295 | Protein ID | WP_001801861.1 |
Coordinates | 1894460..1894555 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1894583..1894640 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FFX42_RS09265 | 1889623..1890273 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
FFX42_RS09270 | 1890354..1891349 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
FFX42_RS09275 | 1891424..1892050 | + | 627 | WP_000669024.1 | hypothetical protein | - |
FFX42_RS09280 | 1892091..1892432 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
FFX42_RS09285 | 1892533..1893105 | + | 573 | WP_000414216.1 | hypothetical protein | - |
FFX42_RS09290 | 1893303..1894315 | - | 1013 | Protein_1785 | IS3 family transposase | - |
FFX42_RS09295 | 1894460..1894555 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1894583..1894640 | - | 58 | - | - | Antitoxin |
FFX42_RS09300 | 1894678..1894779 | + | 102 | WP_001792025.1 | hypothetical protein | - |
FFX42_RS09305 | 1894757..1894918 | - | 162 | Protein_1788 | transposase | - |
FFX42_RS09310 | 1894909..1895403 | - | 495 | Protein_1789 | transposase | - |
FFX42_RS09315 | 1895855..1897084 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
FFX42_RS09320 | 1897077..1898633 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
FFX42_RS09325 | 1898797..1898931 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA / selk | 1870442..1921473 | 51031 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T126423 WP_001801861.1 NZ_CP040665:1894460-1894555 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T126423 NZ_CP040665:1894460-1894555 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT126423 NZ_CP040665:c1894640-1894583 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|