Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3661196..3661418 | Replicon | chromosome |
| Accession | NZ_CP040664 | ||
| Organism | Escherichia coli strain KR2009 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1E8T8 |
| Locus tag | FE384_RS17875 | Protein ID | WP_000141634.1 |
| Coordinates | 3661196..3661303 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3661352..3661418 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FE384_RS17850 | 3656449..3657201 | - | 753 | Protein_3475 | cellulose biosynthesis protein BcsQ | - |
| FE384_RS17855 | 3657213..3657401 | - | 189 | WP_001063318.1 | YhjR family protein | - |
| FE384_RS17860 | 3657674..3659245 | + | 1572 | WP_138817882.1 | cellulose biosynthesis protein BcsE | - |
| FE384_RS17865 | 3659242..3659433 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| FE384_RS17870 | 3659430..3661109 | + | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
| FE384_RS17875 | 3661196..3661303 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
| - | 3661352..3661418 | + | 67 | - | - | Antitoxin |
| FE384_RS17885 | 3661779..3663050 | + | 1272 | WP_001295225.1 | transporter | - |
| FE384_RS17890 | 3663080..3664084 | - | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| FE384_RS17895 | 3664081..3665064 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| FE384_RS17900 | 3665075..3665977 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T126413 WP_000141634.1 NZ_CP040664:c3661303-3661196 [Escherichia coli]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T126413 NZ_CP040664:c3661303-3661196 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT126413 NZ_CP040664:3661352-3661418 [Escherichia coli]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|