Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1405401..1405623 Replicon chromosome
Accession NZ_CP040643
Organism Escherichia coli strain BE104

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag FGC38_RS07050 Protein ID WP_000170955.1
Coordinates 1405401..1405508 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1405556..1405623 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FGC38_RS07010 1401257..1402090 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
FGC38_RS07015 1402087..1402479 + 393 WP_000200374.1 invasion regulator SirB2 -
FGC38_RS07020 1402483..1403292 + 810 WP_001257044.1 invasion regulator SirB1 -
FGC38_RS07025 1403328..1404182 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
FGC38_RS07030 1404331..1404438 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1404486..1404552 + 67 NuclAT_35 - -
- 1404486..1404552 + 67 NuclAT_35 - -
- 1404486..1404552 + 67 NuclAT_35 - -
- 1404486..1404552 + 67 NuclAT_35 - -
- 1404486..1404552 + 67 NuclAT_37 - -
- 1404486..1404552 + 67 NuclAT_37 - -
- 1404486..1404552 + 67 NuclAT_37 - -
- 1404486..1404552 + 67 NuclAT_37 - -
- 1404486..1404552 + 67 NuclAT_39 - -
- 1404486..1404552 + 67 NuclAT_39 - -
- 1404486..1404552 + 67 NuclAT_39 - -
- 1404486..1404552 + 67 NuclAT_39 - -
- 1404486..1404552 + 67 NuclAT_41 - -
- 1404486..1404552 + 67 NuclAT_41 - -
- 1404486..1404552 + 67 NuclAT_41 - -
- 1404486..1404552 + 67 NuclAT_41 - -
- 1404486..1404552 + 67 NuclAT_43 - -
- 1404486..1404552 + 67 NuclAT_43 - -
- 1404486..1404552 + 67 NuclAT_43 - -
- 1404486..1404552 + 67 NuclAT_43 - -
- 1404488..1404553 + 66 NuclAT_19 - -
- 1404488..1404553 + 66 NuclAT_19 - -
- 1404488..1404553 + 66 NuclAT_19 - -
- 1404488..1404553 + 66 NuclAT_19 - -
- 1404488..1404553 + 66 NuclAT_22 - -
- 1404488..1404553 + 66 NuclAT_22 - -
- 1404488..1404553 + 66 NuclAT_22 - -
- 1404488..1404553 + 66 NuclAT_22 - -
- 1404488..1404553 + 66 NuclAT_25 - -
- 1404488..1404553 + 66 NuclAT_25 - -
- 1404488..1404553 + 66 NuclAT_25 - -
- 1404488..1404553 + 66 NuclAT_25 - -
- 1404488..1404553 + 66 NuclAT_28 - -
- 1404488..1404553 + 66 NuclAT_28 - -
- 1404488..1404553 + 66 NuclAT_28 - -
- 1404488..1404553 + 66 NuclAT_28 - -
- 1404488..1404553 + 66 NuclAT_31 - -
- 1404488..1404553 + 66 NuclAT_31 - -
- 1404488..1404553 + 66 NuclAT_31 - -
- 1404488..1404553 + 66 NuclAT_31 - -
- 1404488..1404553 + 66 NuclAT_34 - -
- 1404488..1404553 + 66 NuclAT_34 - -
- 1404488..1404553 + 66 NuclAT_34 - -
- 1404488..1404553 + 66 NuclAT_34 - -
FGC38_RS07040 1404866..1404973 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 1405021..1405088 + 68 NuclAT_18 - -
- 1405021..1405088 + 68 NuclAT_18 - -
- 1405021..1405088 + 68 NuclAT_18 - -
- 1405021..1405088 + 68 NuclAT_18 - -
- 1405021..1405088 + 68 NuclAT_21 - -
- 1405021..1405088 + 68 NuclAT_21 - -
- 1405021..1405088 + 68 NuclAT_21 - -
- 1405021..1405088 + 68 NuclAT_21 - -
- 1405021..1405088 + 68 NuclAT_24 - -
- 1405021..1405088 + 68 NuclAT_24 - -
- 1405021..1405088 + 68 NuclAT_24 - -
- 1405021..1405088 + 68 NuclAT_24 - -
- 1405021..1405088 + 68 NuclAT_27 - -
- 1405021..1405088 + 68 NuclAT_27 - -
- 1405021..1405088 + 68 NuclAT_27 - -
- 1405021..1405088 + 68 NuclAT_27 - -
- 1405021..1405088 + 68 NuclAT_30 - -
- 1405021..1405088 + 68 NuclAT_30 - -
- 1405021..1405088 + 68 NuclAT_30 - -
- 1405021..1405088 + 68 NuclAT_30 - -
- 1405021..1405088 + 68 NuclAT_33 - -
- 1405021..1405088 + 68 NuclAT_33 - -
- 1405021..1405088 + 68 NuclAT_33 - -
- 1405021..1405088 + 68 NuclAT_33 - -
- 1405022..1405087 + 66 NuclAT_36 - -
- 1405022..1405087 + 66 NuclAT_36 - -
- 1405022..1405087 + 66 NuclAT_36 - -
- 1405022..1405087 + 66 NuclAT_36 - -
- 1405022..1405087 + 66 NuclAT_38 - -
- 1405022..1405087 + 66 NuclAT_38 - -
- 1405022..1405087 + 66 NuclAT_38 - -
- 1405022..1405087 + 66 NuclAT_38 - -
- 1405022..1405087 + 66 NuclAT_40 - -
- 1405022..1405087 + 66 NuclAT_40 - -
- 1405022..1405087 + 66 NuclAT_40 - -
- 1405022..1405087 + 66 NuclAT_40 - -
- 1405022..1405087 + 66 NuclAT_42 - -
- 1405022..1405087 + 66 NuclAT_42 - -
- 1405022..1405087 + 66 NuclAT_42 - -
- 1405022..1405087 + 66 NuclAT_42 - -
- 1405022..1405087 + 66 NuclAT_44 - -
- 1405022..1405087 + 66 NuclAT_44 - -
- 1405022..1405087 + 66 NuclAT_44 - -
- 1405022..1405087 + 66 NuclAT_44 - -
FGC38_RS07050 1405401..1405508 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC Toxin
- 1405556..1405623 + 68 NuclAT_17 - Antitoxin
- 1405556..1405623 + 68 NuclAT_17 - Antitoxin
- 1405556..1405623 + 68 NuclAT_17 - Antitoxin
- 1405556..1405623 + 68 NuclAT_17 - Antitoxin
- 1405556..1405623 + 68 NuclAT_20 - Antitoxin
- 1405556..1405623 + 68 NuclAT_20 - Antitoxin
- 1405556..1405623 + 68 NuclAT_20 - Antitoxin
- 1405556..1405623 + 68 NuclAT_20 - Antitoxin
- 1405556..1405623 + 68 NuclAT_23 - Antitoxin
- 1405556..1405623 + 68 NuclAT_23 - Antitoxin
- 1405556..1405623 + 68 NuclAT_23 - Antitoxin
- 1405556..1405623 + 68 NuclAT_23 - Antitoxin
- 1405556..1405623 + 68 NuclAT_26 - Antitoxin
- 1405556..1405623 + 68 NuclAT_26 - Antitoxin
- 1405556..1405623 + 68 NuclAT_26 - Antitoxin
- 1405556..1405623 + 68 NuclAT_26 - Antitoxin
- 1405556..1405623 + 68 NuclAT_29 - Antitoxin
- 1405556..1405623 + 68 NuclAT_29 - Antitoxin
- 1405556..1405623 + 68 NuclAT_29 - Antitoxin
- 1405556..1405623 + 68 NuclAT_29 - Antitoxin
- 1405556..1405623 + 68 NuclAT_32 - Antitoxin
- 1405556..1405623 + 68 NuclAT_32 - Antitoxin
- 1405556..1405623 + 68 NuclAT_32 - Antitoxin
- 1405556..1405623 + 68 NuclAT_32 - Antitoxin
FGC38_RS07060 1405912..1407012 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
FGC38_RS07065 1407282..1407512 + 231 WP_001146444.1 putative cation transport regulator ChaB -
FGC38_RS07070 1407670..1408365 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
FGC38_RS07075 1408409..1408762 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
FGC38_RS07080 1408947..1410341 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T126256 WP_000170955.1 NZ_CP040643:c1405508-1405401 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T126256 NZ_CP040643:c1405508-1405401 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT126256 NZ_CP040643:1405556-1405623 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A829J2A9


Antitoxin

Download structure file

References