Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2132740..2133039 | Replicon | chromosome |
Accession | NZ_CP040625 | ||
Organism | Staphylococcus aureus strain JKD6004-DR |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
Locus tag | FF960_RS10895 | Protein ID | WP_072482930.1 |
Coordinates | 2132863..2133039 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2132740..2132795 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FF960_RS10840 | 2128298..2128477 | + | 180 | WP_000669789.1 | hypothetical protein | - |
FF960_RS10850 | 2128788..2129048 | + | 261 | WP_001791826.1 | hypothetical protein | - |
FF960_RS10855 | 2129101..2129451 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
FF960_RS10860 | 2129961..2130296 | - | 336 | Protein_2045 | SH3 domain-containing protein | - |
FF960_RS10875 | 2130948..2131439 | - | 492 | WP_000920041.1 | staphylokinase | - |
FF960_RS10880 | 2131630..2132385 | - | 756 | WP_138663901.1 | CHAP domain-containing protein | - |
FF960_RS10885 | 2132397..2132651 | - | 255 | WP_000611512.1 | phage holin | - |
FF960_RS10890 | 2132703..2132810 | + | 108 | Protein_2049 | hypothetical protein | - |
- | 2132732..2132871 | + | 140 | NuclAT_0 | - | - |
- | 2132732..2132871 | + | 140 | NuclAT_0 | - | - |
- | 2132732..2132871 | + | 140 | NuclAT_0 | - | - |
- | 2132732..2132871 | + | 140 | NuclAT_0 | - | - |
- | 2132740..2132795 | + | 56 | - | - | Antitoxin |
FF960_RS10895 | 2132863..2133039 | - | 177 | WP_072482930.1 | putative holin-like toxin | Toxin |
FF960_RS10900 | 2133148..2133921 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
FF960_RS10905 | 2134294..2134668 | - | 375 | WP_000340977.1 | hypothetical protein | - |
FF960_RS10910 | 2134724..2135011 | - | 288 | WP_001262621.1 | hypothetical protein | - |
FF960_RS10915 | 2135057..2135209 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / sea / hlb | 2126979..2176900 | 49921 | |
- | flank | IS/Tn | - | - | 2126979..2128151 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T126212 WP_072482930.1 NZ_CP040625:c2133039-2132863 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
>T126212 NZ_CP040625:c2133039-2132863 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT126212 NZ_CP040625:2132740-2132795 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|