Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1929732..1929914 | Replicon | chromosome |
| Accession | NZ_CP040625 | ||
| Organism | Staphylococcus aureus strain JKD6004-DR | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | FF960_RS09530 | Protein ID | WP_001801861.1 |
| Coordinates | 1929732..1929827 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1929855..1929914 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FF960_RS09480 | 1925392..1926018 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| FF960_RS09485 | 1926059..1926403 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| FF960_RS09490 | 1926501..1927052 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| FF960_RS09495 | 1927270..1927911 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| FF960_RS09500 | 1928025..1928210 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| FF960_RS09505 | 1928212..1928388 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| FF960_RS09510 | 1928399..1928782 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| FF960_RS09520 | 1929386..1929529 | - | 144 | WP_001549059.1 | transposase | - |
| FF960_RS09530 | 1929732..1929827 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1929855..1929914 | - | 60 | - | - | Antitoxin |
| FF960_RS09535 | 1929950..1930051 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| FF960_RS09540 | 1930029..1930205 | - | 177 | Protein_1830 | transposase | - |
| FF960_RS09545 | 1930399..1930776 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1922832..1948433 | 25601 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T126209 WP_001801861.1 NZ_CP040625:1929732-1929827 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T126209 NZ_CP040625:1929732-1929827 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT126209 NZ_CP040625:c1929914-1929855 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|