Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2505655..2505839 | Replicon | chromosome |
Accession | NZ_CP040623 | ||
Organism | Staphylococcus aureus strain D592-HR |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | FF959_RS12815 | Protein ID | WP_000482652.1 |
Coordinates | 2505732..2505839 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2505655..2505715 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FF959_RS12800 | 2501110..2501277 | - | 168 | Protein_2413 | hypothetical protein | - |
FF959_RS12805 | 2501508..2503241 | - | 1734 | WP_000486487.1 | ABC transporter ATP-binding protein/permease | - |
FF959_RS12810 | 2503266..2505029 | - | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
- | 2505655..2505715 | + | 61 | - | - | Antitoxin |
FF959_RS12815 | 2505732..2505839 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
FF959_RS12820 | 2505973..2506359 | - | 387 | WP_000779360.1 | flippase GtxA | - |
FF959_RS12825 | 2506627..2507769 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
FF959_RS12830 | 2507829..2508488 | + | 660 | WP_000831298.1 | membrane protein | - |
FF959_RS12835 | 2508670..2509881 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
FF959_RS12840 | 2510004..2510477 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T126203 WP_000482652.1 NZ_CP040623:c2505839-2505732 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T126203 NZ_CP040623:c2505839-2505732 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT126203 NZ_CP040623:2505655-2505715 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|