Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2131352..2131651 | Replicon | chromosome |
| Accession | NZ_CP040622 | ||
| Organism | Staphylococcus aureus strain JKD6004 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
| Locus tag | FF958_RS10905 | Protein ID | WP_072482930.1 |
| Coordinates | 2131475..2131651 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2131352..2131407 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FF958_RS10850 | 2126910..2127089 | + | 180 | WP_000669789.1 | hypothetical protein | - |
| FF958_RS10860 | 2127400..2127660 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| FF958_RS10865 | 2127713..2128063 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| FF958_RS10870 | 2128573..2128908 | - | 336 | Protein_2046 | SH3 domain-containing protein | - |
| FF958_RS10885 | 2129560..2130051 | - | 492 | WP_000920041.1 | staphylokinase | - |
| FF958_RS10890 | 2130242..2130997 | - | 756 | WP_138663901.1 | CHAP domain-containing protein | - |
| FF958_RS10895 | 2131009..2131263 | - | 255 | WP_000611512.1 | phage holin | - |
| FF958_RS10900 | 2131315..2131422 | + | 108 | Protein_2050 | hypothetical protein | - |
| - | 2131344..2131483 | + | 140 | NuclAT_0 | - | - |
| - | 2131344..2131483 | + | 140 | NuclAT_0 | - | - |
| - | 2131344..2131483 | + | 140 | NuclAT_0 | - | - |
| - | 2131344..2131483 | + | 140 | NuclAT_0 | - | - |
| - | 2131352..2131407 | + | 56 | - | - | Antitoxin |
| FF958_RS10905 | 2131475..2131651 | - | 177 | WP_072482930.1 | putative holin-like toxin | Toxin |
| FF958_RS10910 | 2131760..2132533 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| FF958_RS10915 | 2132906..2133280 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| FF958_RS10920 | 2133336..2133623 | - | 288 | WP_001262621.1 | hypothetical protein | - |
| FF958_RS10925 | 2133669..2133821 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | map / hlb / scn / sak / sea / hlb / groEL | 2122565..2184918 | 62353 | |
| - | flank | IS/Tn | - | - | 2125591..2126763 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T126177 WP_072482930.1 NZ_CP040622:c2131651-2131475 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
>T126177 NZ_CP040622:c2131651-2131475 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT126177 NZ_CP040622:2131352-2131407 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|