Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2553791..2553975 | Replicon | chromosome |
| Accession | NZ_CP040619 | ||
| Organism | Staphylococcus aureus strain J01 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | Q2FVI9 |
| Locus tag | FF957_RS13260 | Protein ID | WP_000482650.1 |
| Coordinates | 2553868..2553975 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2553791..2553851 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FF957_RS13245 | 2549321..2549488 | - | 168 | WP_001789936.1 | hypothetical protein | - |
| FF957_RS13245 | 2549321..2549488 | - | 168 | WP_001789936.1 | hypothetical protein | - |
| FF957_RS13250 | 2549719..2551452 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
| FF957_RS13250 | 2549719..2551452 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
| FF957_RS13255 | 2551477..2553240 | - | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
| FF957_RS13255 | 2551477..2553240 | - | 1764 | WP_001064838.1 | ABC transporter ATP-binding protein/permease | - |
| - | 2553791..2553851 | + | 61 | - | - | Antitoxin |
| FF957_RS13260 | 2553868..2553975 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| FF957_RS13260 | 2553868..2553975 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| FF957_RS13265 | 2554109..2554495 | - | 387 | WP_000779358.1 | flippase GtxA | - |
| FF957_RS13265 | 2554109..2554495 | - | 387 | WP_000779358.1 | flippase GtxA | - |
| FF957_RS13270 | 2554763..2555905 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| FF957_RS13270 | 2554763..2555905 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| FF957_RS13275 | 2555965..2556624 | + | 660 | WP_000831298.1 | membrane protein | - |
| FF957_RS13275 | 2555965..2556624 | + | 660 | WP_000831298.1 | membrane protein | - |
| FF957_RS13280 | 2556806..2558017 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| FF957_RS13280 | 2556806..2558017 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
| FF957_RS13285 | 2558140..2558613 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
| FF957_RS13285 | 2558140..2558613 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T126168 WP_000482650.1 NZ_CP040619:c2553975-2553868 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T126168 NZ_CP040619:c2553975-2553868 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT126168 NZ_CP040619:2553791-2553851 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|