Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2088824..2089123 | Replicon | chromosome |
Accession | NZ_CP040619 | ||
Organism | Staphylococcus aureus strain J01 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | FF957_RS10725 | Protein ID | WP_011447039.1 |
Coordinates | 2088947..2089123 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2088824..2088879 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FF957_RS10680 | 2084155..2084415 | + | 261 | WP_001791826.1 | hypothetical protein | - |
FF957_RS10685 | 2084468..2084818 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
FF957_RS10690 | 2085503..2085952 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
FF957_RS10695 | 2086047..2086382 | - | 336 | Protein_2013 | SH3 domain-containing protein | - |
FF957_RS10705 | 2087032..2087523 | - | 492 | WP_000919350.1 | staphylokinase | - |
FF957_RS10710 | 2087714..2088469 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
FF957_RS10715 | 2088481..2088735 | - | 255 | WP_000611512.1 | phage holin | - |
FF957_RS10720 | 2088787..2088894 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2088816..2088955 | + | 140 | NuclAT_0 | - | - |
- | 2088816..2088955 | + | 140 | NuclAT_0 | - | - |
- | 2088816..2088955 | + | 140 | NuclAT_0 | - | - |
- | 2088816..2088955 | + | 140 | NuclAT_0 | - | - |
- | 2088824..2088879 | + | 56 | - | - | Antitoxin |
FF957_RS10725 | 2088947..2089123 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
FF957_RS10730 | 2089273..2089569 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
FF957_RS10735 | 2089627..2089914 | - | 288 | WP_001040261.1 | hypothetical protein | - |
FF957_RS10740 | 2089961..2090113 | - | 153 | WP_001153681.1 | hypothetical protein | - |
FF957_RS10745 | 2090103..2093888 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2084468..2143474 | 59006 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T126159 WP_011447039.1 NZ_CP040619:c2089123-2088947 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T126159 NZ_CP040619:c2089123-2088947 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT126159 NZ_CP040619:2088824-2088879 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|