Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1885590..1885772 | Replicon | chromosome |
| Accession | NZ_CP040619 | ||
| Organism | Staphylococcus aureus strain J01 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | FF957_RS09370 | Protein ID | WP_001801861.1 |
| Coordinates | 1885590..1885685 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1885713..1885772 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FF957_RS09320 | 1881250..1881876 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| FF957_RS09325 | 1881917..1882261 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| FF957_RS09330 | 1882359..1882910 | + | 552 | WP_000414205.1 | hypothetical protein | - |
| FF957_RS09335 | 1883128..1883769 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| FF957_RS09340 | 1883883..1884068 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| FF957_RS09345 | 1884070..1884246 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| FF957_RS09350 | 1884257..1884640 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| FF957_RS09360 | 1885244..1885387 | - | 144 | WP_001549059.1 | transposase | - |
| FF957_RS09370 | 1885590..1885685 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1885713..1885772 | - | 60 | - | - | Antitoxin |
| FF957_RS09375 | 1885808..1885909 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| FF957_RS09380 | 1885887..1886063 | - | 177 | Protein_1795 | transposase | - |
| FF957_RS09385 | 1886257..1886634 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1880552..1881037 | 485 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T126156 WP_001801861.1 NZ_CP040619:1885590-1885685 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T126156 NZ_CP040619:1885590-1885685 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT126156 NZ_CP040619:c1885772-1885713 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|