Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2990487..2990712 | Replicon | chromosome |
| Accession | NZ_CP040572 | ||
| Organism | Escherichia coli O157:H7 strain ECP17-46 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | FGA21_RS15580 | Protein ID | WP_000813258.1 |
| Coordinates | 2990487..2990642 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2990654..2990712 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGA21_RS15530 | 2985490..2985921 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
| FGA21_RS15545 | 2986372..2987085 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| FGA21_RS15550 | 2987221..2987418 | - | 198 | WP_000917763.1 | hypothetical protein | - |
| FGA21_RS15555 | 2987643..2988197 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
| FGA21_RS15560 | 2988260..2988565 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| FGA21_RS15565 | 2988578..2989627 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| FGA21_RS15570 | 2989629..2989901 | - | 273 | WP_000191871.1 | hypothetical protein | - |
| FGA21_RS15575 | 2990023..2990367 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| FGA21_RS15580 | 2990487..2990642 | - | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 2990654..2990712 | + | 59 | - | - | Antitoxin |
| FGA21_RS15585 | 2990933..2991490 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| FGA21_RS15590 | 2991492..2991710 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
| FGA21_RS15595 | 2991838..2992149 | - | 312 | WP_001289673.1 | hypothetical protein | - |
| FGA21_RS15600 | 2992142..2992369 | - | 228 | WP_000699809.1 | hypothetical protein | - |
| FGA21_RS15605 | 2992366..2992647 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
| FGA21_RS15610 | 2992680..2993396 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| FGA21_RS15615 | 2993430..2993891 | - | 462 | WP_000139447.1 | replication protein | - |
| FGA21_RS15620 | 2993884..2994939 | - | 1056 | WP_001356791.1 | hypothetical protein | - |
| FGA21_RS15625 | 2995008..2995433 | - | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
| FGA21_RS15630 | 2995417..2995660 | - | 244 | Protein_2981 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleG7' | 2953041..3051201 | 98160 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T126081 WP_000813258.1 NZ_CP040572:c2990642-2990487 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T126081 NZ_CP040572:c2990642-2990487 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT126081 NZ_CP040572:2990654-2990712 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|