Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-sokW/Ldr(toxin) |
| Location | 243551..243772 | Replicon | chromosome |
| Accession | NZ_CP040572 | ||
| Organism | Escherichia coli O157:H7 strain ECP17-46 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | FGA21_RS01230 | Protein ID | WP_001295224.1 |
| Coordinates | 243665..243772 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 243551..243616 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGA21_RS01205 | 238991..239893 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| FGA21_RS01210 | 239904..240887 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| FGA21_RS01215 | 240884..241888 | + | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| FGA21_RS01220 | 241918..243189 | - | 1272 | WP_001301684.1 | amino acid permease | - |
| - | 243551..243616 | - | 66 | NuclAT_16 | - | Antitoxin |
| - | 243551..243616 | - | 66 | NuclAT_16 | - | Antitoxin |
| - | 243551..243616 | - | 66 | NuclAT_16 | - | Antitoxin |
| - | 243551..243616 | - | 66 | NuclAT_16 | - | Antitoxin |
| - | 243551..243616 | - | 66 | NuclAT_21 | - | Antitoxin |
| - | 243551..243616 | - | 66 | NuclAT_21 | - | Antitoxin |
| - | 243551..243616 | - | 66 | NuclAT_21 | - | Antitoxin |
| - | 243551..243616 | - | 66 | NuclAT_21 | - | Antitoxin |
| FGA21_RS01230 | 243665..243772 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| FGA21_RS01235 | 243859..245538 | - | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
| FGA21_RS01240 | 245535..245726 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| FGA21_RS01245 | 245723..247294 | - | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
| FGA21_RS01250 | 247567..247755 | + | 189 | WP_001063316.1 | YhjR family protein | - |
| FGA21_RS01255 | 247767..247964 | + | 198 | WP_000279508.1 | AAA family ATPase | - |
| FGA21_RS01260 | 247983..248519 | + | 537 | WP_001270903.1 | cellulose synthase operon protein YhjQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T126068 WP_001295224.1 NZ_CP040572:243665-243772 [Escherichia coli O157:H7]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T126068 NZ_CP040572:243665-243772 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT126068 NZ_CP040572:c243616-243551 [Escherichia coli O157:H7]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|