Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2038172..2038471 | Replicon | chromosome |
Accession | NZ_CP040560 | ||
Organism | Staphylococcus aureus strain Col52-A5 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | FA001_RS10335 | Protein ID | WP_011447039.1 |
Coordinates | 2038295..2038471 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2038172..2038227 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FA001_RS10290 | 2033503..2033763 | + | 261 | WP_001791826.1 | hypothetical protein | - |
FA001_RS10295 | 2033816..2034166 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
FA001_RS10300 | 2034851..2035300 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
FA001_RS10305 | 2035395..2035730 | - | 336 | Protein_1941 | SH3 domain-containing protein | - |
FA001_RS10315 | 2036380..2036871 | - | 492 | WP_000920034.1 | staphylokinase | - |
FA001_RS10320 | 2037062..2037817 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
FA001_RS10325 | 2037829..2038083 | - | 255 | WP_000611512.1 | phage holin | - |
FA001_RS10330 | 2038135..2038242 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2038164..2038303 | + | 140 | NuclAT_0 | - | - |
- | 2038164..2038303 | + | 140 | NuclAT_0 | - | - |
- | 2038164..2038303 | + | 140 | NuclAT_0 | - | - |
- | 2038164..2038303 | + | 140 | NuclAT_0 | - | - |
- | 2038172..2038227 | + | 56 | - | - | Antitoxin |
FA001_RS10335 | 2038295..2038471 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
FA001_RS10340 | 2038621..2038917 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
FA001_RS10345 | 2038975..2039262 | - | 288 | WP_001040261.1 | hypothetical protein | - |
FA001_RS10350 | 2039309..2039461 | - | 153 | WP_001153681.1 | hypothetical protein | - |
FA001_RS10355 | 2039451..2043236 | - | 3786 | WP_000582137.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2033816..2089654 | 55838 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T126017 WP_011447039.1 NZ_CP040560:c2038471-2038295 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T126017 NZ_CP040560:c2038471-2038295 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT126017 NZ_CP040560:2038172-2038227 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|