Detailed information of TA system TA126004

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 105165..105418
• Replicon: plasmid pCR-HvKP5-KPC
• Accession: NZ_CP040547
• Organism: Klebsiella pneumoniae strain CR-HvKP5

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: G9G1E3
• Locus tag: FFT49_RS28590
• Protein ID: WP_001312851.1
• Coordinates: 105165..105314 (-)
• Length: 50 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	105359..105418 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
FFT49_RS28545	100524..100939	-	416	Protein_128	IS1 family transposase	-
FFT49_RS28550	101188..101589	-	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
FFT49_RS28555	101522..101779	-	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
FFT49_RS28560	101872..102525	-	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
FFT49_RS28570	103464..104321	-	858	WP_032495102.1	incFII family plasmid replication initiator RepA	-
FFT49_RS28575	104314..104388	-	75	WP_001375168.1	RepA leader peptide Tap	-
FFT49_RS28585	104633..104881	-	249	WP_000083837.1	replication regulatory protein RepA	-
FFT49_RS28590	105165..105314	-	150	WP_001312851.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	105359..105418	+	60	NuclAT_1	-	Antitoxin
-	105359..105418	+	60	NuclAT_1	-	Antitoxin
-	105359..105418	+	60	NuclAT_1	-	Antitoxin
-	105359..105418	+	60	NuclAT_1	-	Antitoxin
FFT49_RS28600	105619..105849	-	231	WP_001736714.1	hypothetical protein	-
FFT49_RS28605	106013..106612	-	600	WP_032083981.1	hypothetical protein	-
FFT49_RS28610	106998..107198	-	201	WP_015059022.1	hypothetical protein	-
FFT49_RS28615	107330..107890	-	561	WP_000139328.1	fertility inhibition protein FinO	-
FFT49_RS28620	107945..108691	-	747	WP_000205770.1	conjugal transfer pilus acetylase TraX	-
FFT49_RS28625	108711..108872	-	162	Protein_141	DNA helicase	-
FFT49_RS28630	108936..109640	+	705	WP_001067855.1	IS6-like element IS26 family transposase	-
FFT49_RS28635	109693..109758	+	66	Protein_143	helix-turn-helix domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaKPC-2 / rmtB / blaTEM-1B / fosA3 / blaCTX-M-65 / catA2	-	1..177587	177587

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-45)

Sequences

Toxin

Protein

• Length: 50 a.a.
• Molecular weight: 5542.67 Da
• Isoelectric Point: 8.7678

>T126004 WP_001312851.1 NZ_CP040547:c105314-105165 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 150 bp

>T126004 NZ_CP040547:c105314-105165 [Klebsiella pneumoniae]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT126004 NZ_CP040547:105359-105418 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A829C8K5

Antitoxin