Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 37143..37413 | Replicon | plasmid pCR-HvKP4-pKPC |
Accession | NZ_CP040541 | ||
Organism | Klebsiella pneumoniae strain CR-HvKP4 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | FFT48_RS28100 | Protein ID | WP_001312861.1 |
Coordinates | 37255..37413 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 37143..37206 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FFT48_RS28075 | 32854..33381 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
FFT48_RS28080 | 33439..33672 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
FFT48_RS28085 | 33733..35756 | + | 2024 | Protein_45 | ParB/RepB/Spo0J family partition protein | - |
FFT48_RS28090 | 35825..36259 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
FFT48_RS28095 | 36256..36975 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 36987..37211 | + | 225 | NuclAT_0 | - | - |
- | 36987..37211 | + | 225 | NuclAT_0 | - | - |
- | 36987..37211 | + | 225 | NuclAT_0 | - | - |
- | 36987..37211 | + | 225 | NuclAT_0 | - | - |
- | 37143..37206 | - | 64 | - | - | Antitoxin |
FFT48_RS28100 | 37255..37413 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
FFT48_RS30575 | 37651..38028 | - | 378 | Protein_49 | hypothetical protein | - |
FFT48_RS28120 | 38328..38624 | + | 297 | WP_001272251.1 | hypothetical protein | - |
FFT48_RS28125 | 38735..39556 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
FFT48_RS28130 | 39853..40500 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
FFT48_RS28135 | 40777..41160 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
FFT48_RS28140 | 41351..42037 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
FFT48_RS28145 | 42131..42358 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2 / catA2 | - | 1..177585 | 177585 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T125968 WP_001312861.1 NZ_CP040541:37255-37413 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T125968 NZ_CP040541:37255-37413 [Klebsiella pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT125968 NZ_CP040541:c37206-37143 [Klebsiella pneumoniae]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|