Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 104270..104540 | Replicon | plasmid pCR-HvKP1-KPC |
Accession | NZ_CP040535 | ||
Organism | Klebsiella pneumoniae strain CR-HvKP1 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | FFT47_RS28630 | Protein ID | WP_001312861.1 |
Coordinates | 104382..104540 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 104270..104333 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FFT47_RS28605 | 99981..100508 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
FFT47_RS28610 | 100566..100799 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
FFT47_RS28615 | 100860..102883 | + | 2024 | Protein_141 | ParB/RepB/Spo0J family partition protein | - |
FFT47_RS28620 | 102952..103386 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
FFT47_RS28625 | 103383..104102 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 104114..104338 | + | 225 | NuclAT_0 | - | - |
- | 104114..104338 | + | 225 | NuclAT_0 | - | - |
- | 104114..104338 | + | 225 | NuclAT_0 | - | - |
- | 104114..104338 | + | 225 | NuclAT_0 | - | - |
- | 104270..104333 | - | 64 | - | - | Antitoxin |
FFT47_RS28630 | 104382..104540 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
FFT47_RS30540 | 104778..105155 | - | 378 | Protein_145 | hypothetical protein | - |
FFT47_RS28650 | 105455..105751 | + | 297 | WP_001272251.1 | hypothetical protein | - |
FFT47_RS28655 | 105862..106683 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
FFT47_RS28660 | 106980..107627 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
FFT47_RS28665 | 107904..108287 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
FFT47_RS28670 | 108478..109164 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
FFT47_RS28675 | 109258..109485 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | catA2 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2 | - | 1..177591 | 177591 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T125938 WP_001312861.1 NZ_CP040535:104382-104540 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T125938 NZ_CP040535:104382-104540 [Klebsiella pneumoniae]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT125938 NZ_CP040535:c104333-104270 [Klebsiella pneumoniae]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|