Detailed information of TA system TA125934

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 66031..66284
• Replicon: plasmid pCR-HvKP1-KPC
• Accession: NZ_CP040535
• Organism: Klebsiella pneumoniae strain CR-HvKP1

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: G9G1E3
• Locus tag: FFT47_RS28315
• Protein ID: WP_001312851.1
• Coordinates: 66135..66284 (+)
• Length: 50 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	66031..66090 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
FFT47_RS28270	61691..61756	-	66	Protein_85	helix-turn-helix domain-containing protein	-
FFT47_RS28275	61809..62513	-	705	WP_001067855.1	IS6-like element IS26 family transposase	-
FFT47_RS28280	62577..62738	+	162	Protein_87	DNA helicase	-
FFT47_RS28285	62758..63504	+	747	WP_000205770.1	conjugal transfer pilus acetylase TraX	-
FFT47_RS28290	63559..64119	+	561	WP_000139328.1	fertility inhibition protein FinO	-
FFT47_RS28295	64251..64451	+	201	WP_015059022.1	hypothetical protein	-
FFT47_RS28300	64837..65436	+	600	WP_032083981.1	hypothetical protein	-
FFT47_RS28305	65600..65830	+	231	WP_001736714.1	hypothetical protein	-
-	66031..66090	-	60	NuclAT_1	-	Antitoxin
-	66031..66090	-	60	NuclAT_1	-	Antitoxin
-	66031..66090	-	60	NuclAT_1	-	Antitoxin
-	66031..66090	-	60	NuclAT_1	-	Antitoxin
FFT47_RS28315	66135..66284	+	150	WP_001312851.1	type I toxin-antitoxin system Hok family toxin	Toxin
FFT47_RS28320	66568..66816	+	249	WP_000083837.1	replication regulatory protein RepA	-
FFT47_RS28330	67061..67135	+	75	WP_001375168.1	RepA leader peptide Tap	-
FFT47_RS28335	67128..67985	+	858	WP_032495102.1	incFII family plasmid replication initiator RepA	-
FFT47_RS28345	68924..69577	+	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
FFT47_RS28350	69670..69927	+	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
FFT47_RS28355	69860..70261	+	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-
FFT47_RS28360	70510..70925	+	416	Protein_100	IS1 family transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	catA2 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2	-	1..177591	177591

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-45)

Sequences

Toxin

Protein

• Length: 50 a.a.
• Molecular weight: 5542.67 Da
• Isoelectric Point: 8.7678

>T125934 WP_001312851.1 NZ_CP040535:66135-66284 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 150 bp

>T125934 NZ_CP040535:66135-66284 [Klebsiella pneumoniae]
ATGACGAAATATGCCCTTATCGGGTTGCTCGCCGTGTGTGCCACGGTATTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT125934 NZ_CP040535:c66090-66031 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A829C8K5

Antitoxin