Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 226230..226452 | Replicon | chromosome |
| Accession | NZ_CP040456 | ||
| Organism | Escherichia coli strain UPEC132 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A0D6GD35 |
| Locus tag | FE252_RS02635 | Protein ID | WP_000170745.1 |
| Coordinates | 226345..226452 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 226230..226288 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FE252_RS02610 | 221671..222573 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| FE252_RS02615 | 222584..223567 | + | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
| FE252_RS02620 | 223564..224568 | + | 1005 | WP_000103583.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| FE252_RS02625 | 224598..225869 | - | 1272 | WP_001467807.1 | amino acid permease | - |
| - | 226230..226288 | - | 59 | - | - | Antitoxin |
| FE252_RS02635 | 226345..226452 | + | 108 | WP_000170745.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| FE252_RS02640 | 226539..228218 | - | 1680 | WP_000191567.1 | cellulose biosynthesis protein BcsG | - |
| FE252_RS02645 | 228215..228406 | - | 192 | WP_000988311.1 | cellulose biosynthesis protein BcsF | - |
| FE252_RS02650 | 228403..229974 | - | 1572 | WP_001204945.1 | cellulose biosynthesis protein BcsE | - |
| FE252_RS02655 | 230247..230435 | + | 189 | WP_001063314.1 | YhjR family protein | - |
| FE252_RS02660 | 230447..231199 | + | 753 | WP_000279525.1 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3855.68 Da Isoelectric Point: 9.0157
>T125838 WP_000170745.1 NZ_CP040456:226345-226452 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVSWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVSWLNKRK
Download Length: 108 bp
>T125838 NZ_CP040456:226345-226452 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT125838 NZ_CP040456:c226288-226230 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|