Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 41553..41806 | Replicon | plasmid unnamed1 |
Accession | NZ_CP040454 | ||
Organism | Escherichia coli strain UPEC132 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | A0A148HBD8 |
Locus tag | FE252_RS00245 | Protein ID | WP_001336447.1 |
Coordinates | 41553..41702 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 41750..41806 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FE252_RS00195 | 37357..38004 | + | 648 | WP_021515401.1 | hypothetical protein | - |
FE252_RS00200 | 38229..38528 | - | 300 | WP_021515402.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
FE252_RS00205 | 38518..38781 | - | 264 | WP_001089474.1 | hypothetical protein | - |
FE252_RS00210 | 38888..39148 | - | 261 | WP_024187481.1 | hypothetical protein | - |
FE252_RS00225 | 39851..40708 | - | 858 | WP_145747938.1 | incFII family plasmid replication initiator RepA | - |
FE252_RS00230 | 40701..40775 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
FE252_RS00240 | 41011..41268 | - | 258 | WP_000084404.1 | replication regulatory protein RepA | - |
FE252_RS00245 | 41553..41702 | - | 150 | WP_001336447.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 41750..41806 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 41750..41806 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 41750..41806 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 41750..41806 | + | 57 | NuclAT_1 | - | Antitoxin |
FE252_RS00255 | 41901..42338 | - | 438 | WP_000872609.1 | hypothetical protein | - |
FE252_RS27395 | 42491..42875 | - | 385 | Protein_41 | hypothetical protein | - |
FE252_RS00270 | 42978..43439 | - | 462 | WP_145747939.1 | thermonuclease family protein | - |
FE252_RS00275 | 44181..44384 | - | 204 | WP_001336517.1 | hypothetical protein | - |
FE252_RS00280 | 44536..45093 | - | 558 | WP_000139329.1 | fertility inhibition protein FinO | - |
FE252_RS00285 | 45148..45894 | - | 747 | WP_113318688.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | senB | 1..117139 | 117139 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5572.69 Da Isoelectric Point: 8.7678
>T125830 WP_001336447.1 NZ_CP040454:c41702-41553 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T125830 NZ_CP040454:c41702-41553 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAATATACCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 57 bp
>AT125830 NZ_CP040454:41750-41806 [Escherichia coli]
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|