Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
Location | 5165663..5165884 | Replicon | chromosome |
Accession | NZ_CP040316 | ||
Organism | Escherichia coli strain CV261 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | FEL12_RS25530 | Protein ID | WP_001295224.1 |
Coordinates | 5165663..5165770 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | ohsC | ||
Locus tag | - | ||
Coordinates | 5165819..5165884 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FEL12_RS25505 | 5160916..5161668 | - | 753 | Protein_4970 | cellulose biosynthesis protein BcsQ | - |
FEL12_RS25510 | 5161680..5161868 | - | 189 | WP_001063316.1 | YhjR family protein | - |
FEL12_RS25515 | 5162141..5163712 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
FEL12_RS25520 | 5163709..5163900 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
FEL12_RS25525 | 5163897..5165576 | + | 1680 | WP_001691049.1 | cellulose biosynthesis protein BcsG | - |
FEL12_RS25530 | 5165663..5165770 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 5165819..5165884 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 5165819..5165884 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 5165819..5165884 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 5165819..5165884 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 5165819..5165884 | + | 66 | NuclAT_21 | - | Antitoxin |
- | 5165819..5165884 | + | 66 | NuclAT_21 | - | Antitoxin |
- | 5165819..5165884 | + | 66 | NuclAT_21 | - | Antitoxin |
- | 5165819..5165884 | + | 66 | NuclAT_21 | - | Antitoxin |
FEL12_RS25535 | 5166246..5167517 | + | 1272 | WP_001301684.1 | amino acid permease | - |
FEL12_RS25540 | 5167547..5168551 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
FEL12_RS25545 | 5168548..5169531 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
FEL12_RS25550 | 5169542..5170444 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T125555 WP_001295224.1 NZ_CP040316:c5165770-5165663 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T125555 NZ_CP040316:c5165770-5165663 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT125555 NZ_CP040316:5165819-5165884 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|