Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2588238..2588463 | Replicon | chromosome |
Accession | NZ_CP040316 | ||
Organism | Escherichia coli strain CV261 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | FEL12_RS12755 | Protein ID | WP_000935259.1 |
Coordinates | 2588251..2588463 (+) | Length | 71 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2588238..2588296 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FEL12_RS12705 | 2583344..2583586 | + | 243 | WP_000747948.1 | hypothetical protein | - |
FEL12_RS12710 | 2583570..2583995 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
FEL12_RS12715 | 2584064..2585107 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
FEL12_RS12720 | 2585100..2585561 | + | 462 | WP_000139447.1 | replication protein | - |
FEL12_RS12725 | 2585595..2586270 | + | 676 | Protein_2470 | DUF1627 domain-containing protein | - |
FEL12_RS12730 | 2586303..2586584 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
FEL12_RS12735 | 2586581..2586808 | + | 228 | WP_000699809.1 | hypothetical protein | - |
FEL12_RS12740 | 2586801..2587112 | + | 312 | WP_001289673.1 | hypothetical protein | - |
FEL12_RS12745 | 2587240..2587458 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
FEL12_RS12750 | 2587460..2588017 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
- | 2588238..2588296 | - | 59 | - | - | Antitoxin |
FEL12_RS12755 | 2588251..2588463 | + | 213 | WP_000935259.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
FEL12_RS12760 | 2588583..2588927 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
FEL12_RS12765 | 2589049..2589321 | + | 273 | WP_000191872.1 | hypothetical protein | - |
FEL12_RS12770 | 2589323..2590372 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
FEL12_RS12775 | 2590385..2590690 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
FEL12_RS12780 | 2590753..2591307 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
FEL12_RS12785 | 2591532..2591729 | + | 198 | WP_000917763.1 | hypothetical protein | - |
FEL12_RS12790 | 2591865..2592578 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
FEL12_RS12805 | 2593029..2593460 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | paa / nleG7' | 2522279..2625567 | 103288 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7887.47 Da Isoelectric Point: 9.2654
>T125534 WP_000935259.1 NZ_CP040316:2588251-2588463 [Escherichia coli]
MLNTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MLNTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 213 bp
>T125534 NZ_CP040316:2588251-2588463 [Escherichia coli]
ATGCTGAACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTGCGAATCC
GAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGCTGAACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTGCGAATCC
GAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT125534 NZ_CP040316:c2588296-2588238 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|