Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2445242..2445456 Replicon chromosome
Accession NZ_CP040316
Organism Escherichia coli strain CV261

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag FEL12_RS11810 Protein ID WP_000170963.1
Coordinates 2445242..2445349 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2445397..2445456 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FEL12_RS11780 2440551..2441633 + 1083 WP_000804726.1 peptide chain release factor 1 -
FEL12_RS11785 2441633..2442466 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
FEL12_RS11790 2442463..2442855 + 393 WP_000200379.1 invasion regulator SirB2 -
FEL12_RS11795 2442859..2443668 + 810 WP_001257044.1 invasion regulator SirB1 -
FEL12_RS11800 2443704..2444558 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
FEL12_RS11805 2444706..2444813 - 108 WP_077827457.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2444866..2444927 + 62 NuclAT_24 - -
- 2444866..2444927 + 62 NuclAT_24 - -
- 2444866..2444927 + 62 NuclAT_24 - -
- 2444866..2444927 + 62 NuclAT_24 - -
- 2444866..2444927 + 62 NuclAT_26 - -
- 2444866..2444927 + 62 NuclAT_26 - -
- 2444866..2444927 + 62 NuclAT_26 - -
- 2444866..2444927 + 62 NuclAT_26 - -
- 2444866..2444927 + 62 NuclAT_28 - -
- 2444866..2444927 + 62 NuclAT_28 - -
- 2444866..2444927 + 62 NuclAT_28 - -
- 2444866..2444927 + 62 NuclAT_28 - -
- 2444866..2444927 + 62 NuclAT_30 - -
- 2444866..2444927 + 62 NuclAT_30 - -
- 2444866..2444927 + 62 NuclAT_30 - -
- 2444866..2444927 + 62 NuclAT_30 - -
- 2444866..2444927 + 62 NuclAT_32 - -
- 2444866..2444927 + 62 NuclAT_32 - -
- 2444866..2444927 + 62 NuclAT_32 - -
- 2444866..2444927 + 62 NuclAT_32 - -
- 2444866..2444928 + 63 NuclAT_17 - -
- 2444866..2444928 + 63 NuclAT_17 - -
- 2444866..2444928 + 63 NuclAT_17 - -
- 2444866..2444928 + 63 NuclAT_17 - -
- 2444866..2444928 + 63 NuclAT_18 - -
- 2444866..2444928 + 63 NuclAT_18 - -
- 2444866..2444928 + 63 NuclAT_18 - -
- 2444866..2444928 + 63 NuclAT_18 - -
- 2444866..2444928 + 63 NuclAT_19 - -
- 2444866..2444928 + 63 NuclAT_19 - -
- 2444866..2444928 + 63 NuclAT_19 - -
- 2444866..2444928 + 63 NuclAT_19 - -
- 2444866..2444928 + 63 NuclAT_20 - -
- 2444866..2444928 + 63 NuclAT_20 - -
- 2444866..2444928 + 63 NuclAT_20 - -
- 2444866..2444928 + 63 NuclAT_20 - -
- 2444866..2444928 + 63 NuclAT_22 - -
- 2444866..2444928 + 63 NuclAT_22 - -
- 2444866..2444928 + 63 NuclAT_22 - -
- 2444866..2444928 + 63 NuclAT_22 - -
- 2444866..2444928 + 63 NuclAT_23 - -
- 2444866..2444928 + 63 NuclAT_23 - -
- 2444866..2444928 + 63 NuclAT_23 - -
- 2444866..2444928 + 63 NuclAT_23 - -
FEL12_RS11810 2445242..2445349 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 2445397..2445456 + 60 NuclAT_25 - Antitoxin
- 2445397..2445456 + 60 NuclAT_25 - Antitoxin
- 2445397..2445456 + 60 NuclAT_25 - Antitoxin
- 2445397..2445456 + 60 NuclAT_25 - Antitoxin
- 2445397..2445456 + 60 NuclAT_27 - Antitoxin
- 2445397..2445456 + 60 NuclAT_27 - Antitoxin
- 2445397..2445456 + 60 NuclAT_27 - Antitoxin
- 2445397..2445456 + 60 NuclAT_27 - Antitoxin
- 2445397..2445456 + 60 NuclAT_29 - Antitoxin
- 2445397..2445456 + 60 NuclAT_29 - Antitoxin
- 2445397..2445456 + 60 NuclAT_29 - Antitoxin
- 2445397..2445456 + 60 NuclAT_29 - Antitoxin
- 2445397..2445456 + 60 NuclAT_31 - Antitoxin
- 2445397..2445456 + 60 NuclAT_31 - Antitoxin
- 2445397..2445456 + 60 NuclAT_31 - Antitoxin
- 2445397..2445456 + 60 NuclAT_31 - Antitoxin
- 2445397..2445456 + 60 NuclAT_33 - Antitoxin
- 2445397..2445456 + 60 NuclAT_33 - Antitoxin
- 2445397..2445456 + 60 NuclAT_33 - Antitoxin
- 2445397..2445456 + 60 NuclAT_33 - Antitoxin
FEL12_RS11815 2445748..2446848 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
FEL12_RS11820 2447118..2447348 + 231 WP_001146444.1 putative cation transport regulator ChaB -
FEL12_RS11825 2447509..2448204 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
FEL12_RS11830 2448248..2448601 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
FEL12_RS11835 2448787..2450181 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T125532 WP_000170963.1 NZ_CP040316:c2445349-2445242 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T125532 NZ_CP040316:c2445349-2445242 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT125532 NZ_CP040316:2445397-2445456 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References