Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
Location | 5183954..5184175 | Replicon | chromosome |
Accession | NZ_CP040314 | ||
Organism | Escherichia coli strain MA11 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | FEL10_RS25630 | Protein ID | WP_001295224.1 |
Coordinates | 5183954..5184061 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | ohsC | ||
Locus tag | - | ||
Coordinates | 5184110..5184175 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FEL10_RS25605 | 5179207..5179959 | - | 753 | Protein_4983 | cellulose biosynthesis protein BcsQ | - |
FEL10_RS25610 | 5179971..5180159 | - | 189 | WP_001063316.1 | YhjR family protein | - |
FEL10_RS25615 | 5180432..5182003 | + | 1572 | WP_001204920.1 | cellulose biosynthesis protein BcsE | - |
FEL10_RS25620 | 5182000..5182191 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
FEL10_RS25625 | 5182188..5183867 | + | 1680 | WP_000191592.1 | cellulose biosynthesis protein BcsG | - |
FEL10_RS25630 | 5183954..5184061 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 5184110..5184175 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 5184110..5184175 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 5184110..5184175 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 5184110..5184175 | + | 66 | NuclAT_16 | - | Antitoxin |
- | 5184110..5184175 | + | 66 | NuclAT_21 | - | Antitoxin |
- | 5184110..5184175 | + | 66 | NuclAT_21 | - | Antitoxin |
- | 5184110..5184175 | + | 66 | NuclAT_21 | - | Antitoxin |
- | 5184110..5184175 | + | 66 | NuclAT_21 | - | Antitoxin |
FEL10_RS25635 | 5184537..5185808 | + | 1272 | WP_001301684.1 | amino acid permease | - |
FEL10_RS25640 | 5185838..5186842 | - | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
FEL10_RS25645 | 5186839..5187822 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
FEL10_RS25650 | 5187833..5188735 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T125513 WP_001295224.1 NZ_CP040314:c5184061-5183954 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T125513 NZ_CP040314:c5184061-5183954 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 66 bp
>AT125513 NZ_CP040314:5184110-5184175 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|