Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2516948..2517173 | Replicon | chromosome |
Accession | NZ_CP040314 | ||
Organism | Escherichia coli strain MA11 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | FEL10_RS12290 | Protein ID | WP_000935259.1 |
Coordinates | 2516961..2517173 (+) | Length | 71 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2516948..2517006 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FEL10_RS12240 | 2512013..2512255 | + | 243 | WP_000747948.1 | hypothetical protein | - |
FEL10_RS12245 | 2512239..2512664 | + | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
FEL10_RS12250 | 2512733..2513776 | + | 1044 | WP_001262402.1 | hypothetical protein | - |
FEL10_RS12255 | 2513769..2514230 | + | 462 | WP_000139447.1 | replication protein | - |
FEL10_RS12260 | 2514264..2514980 | + | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
FEL10_RS12265 | 2515013..2515294 | + | 282 | WP_000603384.1 | DNA-binding protein | - |
FEL10_RS12270 | 2515291..2515518 | + | 228 | WP_000699809.1 | hypothetical protein | - |
FEL10_RS12275 | 2515511..2515822 | + | 312 | WP_001289673.1 | hypothetical protein | - |
FEL10_RS12280 | 2515950..2516168 | + | 219 | WP_000683609.1 | DUF4014 family protein | - |
FEL10_RS12285 | 2516170..2516727 | + | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
- | 2516948..2517006 | - | 59 | - | - | Antitoxin |
FEL10_RS12290 | 2516961..2517173 | + | 213 | WP_000935259.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
FEL10_RS12295 | 2517293..2517637 | + | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
FEL10_RS12300 | 2517759..2518031 | + | 273 | WP_000191872.1 | hypothetical protein | - |
FEL10_RS12305 | 2518033..2519082 | + | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
FEL10_RS12310 | 2519095..2519400 | + | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
FEL10_RS12315 | 2519463..2520017 | + | 555 | WP_000640035.1 | DUF1133 family protein | - |
FEL10_RS12320 | 2520242..2520439 | + | 198 | WP_000917763.1 | hypothetical protein | - |
FEL10_RS12325 | 2520575..2521288 | + | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
FEL10_RS12340 | 2521739..2522170 | + | 432 | WP_001302123.1 | tellurite resistance protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | paa / nleG7' | 2453339..2554278 | 100939 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7887.47 Da Isoelectric Point: 9.2654
>T125491 WP_000935259.1 NZ_CP040314:2516961-2517173 [Escherichia coli]
MLNTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MLNTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 213 bp
>T125491 NZ_CP040314:2516961-2517173 [Escherichia coli]
ATGCTGAACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTGCGAATCC
GAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGCTGAACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTGCGAATCC
GAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT125491 NZ_CP040314:c2517006-2516948 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|