Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2415510..2415724 | Replicon | chromosome |
| Accession | NZ_CP040314 | ||
| Organism | Escherichia coli strain MA11 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | J7R083 |
| Locus tag | FEL10_RS11655 | Protein ID | WP_000170963.1 |
| Coordinates | 2415510..2415617 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2415665..2415724 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FEL10_RS11625 | 2410819..2411901 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| FEL10_RS11630 | 2411901..2412734 | + | 834 | WP_000456466.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| FEL10_RS11635 | 2412731..2413123 | + | 393 | WP_000200379.1 | invasion regulator SirB2 | - |
| FEL10_RS11640 | 2413127..2413936 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| FEL10_RS11645 | 2413972..2414826 | + | 855 | WP_000811067.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| FEL10_RS11650 | 2414974..2415081 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2415134..2415195 | + | 62 | NuclAT_24 | - | - |
| - | 2415134..2415195 | + | 62 | NuclAT_24 | - | - |
| - | 2415134..2415195 | + | 62 | NuclAT_24 | - | - |
| - | 2415134..2415195 | + | 62 | NuclAT_24 | - | - |
| - | 2415134..2415195 | + | 62 | NuclAT_26 | - | - |
| - | 2415134..2415195 | + | 62 | NuclAT_26 | - | - |
| - | 2415134..2415195 | + | 62 | NuclAT_26 | - | - |
| - | 2415134..2415195 | + | 62 | NuclAT_26 | - | - |
| - | 2415134..2415195 | + | 62 | NuclAT_28 | - | - |
| - | 2415134..2415195 | + | 62 | NuclAT_28 | - | - |
| - | 2415134..2415195 | + | 62 | NuclAT_28 | - | - |
| - | 2415134..2415195 | + | 62 | NuclAT_28 | - | - |
| - | 2415134..2415195 | + | 62 | NuclAT_30 | - | - |
| - | 2415134..2415195 | + | 62 | NuclAT_30 | - | - |
| - | 2415134..2415195 | + | 62 | NuclAT_30 | - | - |
| - | 2415134..2415195 | + | 62 | NuclAT_30 | - | - |
| - | 2415134..2415195 | + | 62 | NuclAT_32 | - | - |
| - | 2415134..2415195 | + | 62 | NuclAT_32 | - | - |
| - | 2415134..2415195 | + | 62 | NuclAT_32 | - | - |
| - | 2415134..2415195 | + | 62 | NuclAT_32 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_17 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_17 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_17 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_17 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_18 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_18 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_18 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_18 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_19 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_19 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_19 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_19 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_20 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_20 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_20 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_20 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_22 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_22 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_22 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_22 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_23 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_23 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_23 | - | - |
| - | 2415134..2415196 | + | 63 | NuclAT_23 | - | - |
| FEL10_RS11655 | 2415510..2415617 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | Toxin |
| - | 2415665..2415724 | + | 60 | NuclAT_25 | - | Antitoxin |
| - | 2415665..2415724 | + | 60 | NuclAT_25 | - | Antitoxin |
| - | 2415665..2415724 | + | 60 | NuclAT_25 | - | Antitoxin |
| - | 2415665..2415724 | + | 60 | NuclAT_25 | - | Antitoxin |
| - | 2415665..2415724 | + | 60 | NuclAT_27 | - | Antitoxin |
| - | 2415665..2415724 | + | 60 | NuclAT_27 | - | Antitoxin |
| - | 2415665..2415724 | + | 60 | NuclAT_27 | - | Antitoxin |
| - | 2415665..2415724 | + | 60 | NuclAT_27 | - | Antitoxin |
| - | 2415665..2415724 | + | 60 | NuclAT_29 | - | Antitoxin |
| - | 2415665..2415724 | + | 60 | NuclAT_29 | - | Antitoxin |
| - | 2415665..2415724 | + | 60 | NuclAT_29 | - | Antitoxin |
| - | 2415665..2415724 | + | 60 | NuclAT_29 | - | Antitoxin |
| - | 2415665..2415724 | + | 60 | NuclAT_31 | - | Antitoxin |
| - | 2415665..2415724 | + | 60 | NuclAT_31 | - | Antitoxin |
| - | 2415665..2415724 | + | 60 | NuclAT_31 | - | Antitoxin |
| - | 2415665..2415724 | + | 60 | NuclAT_31 | - | Antitoxin |
| - | 2415665..2415724 | + | 60 | NuclAT_33 | - | Antitoxin |
| - | 2415665..2415724 | + | 60 | NuclAT_33 | - | Antitoxin |
| - | 2415665..2415724 | + | 60 | NuclAT_33 | - | Antitoxin |
| - | 2415665..2415724 | + | 60 | NuclAT_33 | - | Antitoxin |
| FEL10_RS11660 | 2416016..2417116 | - | 1101 | WP_001301956.1 | sodium-potassium/proton antiporter ChaA | - |
| FEL10_RS11665 | 2417386..2417616 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| FEL10_RS11670 | 2417777..2418472 | + | 696 | WP_001301489.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| FEL10_RS11675 | 2418516..2418869 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| FEL10_RS11680 | 2419055..2420449 | + | 1395 | WP_000086192.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T125489 WP_000170963.1 NZ_CP040314:c2415617-2415510 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T125489 NZ_CP040314:c2415617-2415510 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT125489 NZ_CP040314:2415665-2415724 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|