Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1964995..1965220 | Replicon | chromosome |
Accession | NZ_CP040314 | ||
Organism | Escherichia coli strain MA11 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | FEL10_RS09140 | Protein ID | WP_000813263.1 |
Coordinates | 1965065..1965220 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1964995..1965053 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FEL10_RS09110 | 1960270..1961361 | + | 1092 | WP_001205823.1 | hypothetical protein | - |
FEL10_RS09115 | 1961368..1962114 | + | 747 | WP_000788751.1 | ATP-binding protein | - |
FEL10_RS09120 | 1962136..1962906 | + | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
FEL10_RS09125 | 1962922..1963335 | + | 414 | WP_001151233.1 | DUF977 family protein | - |
FEL10_RS09130 | 1963687..1964460 | - | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
- | 1964995..1965053 | - | 59 | - | - | Antitoxin |
FEL10_RS09140 | 1965065..1965220 | + | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
FEL10_RS09145 | 1965388..1965666 | + | 279 | WP_001341388.1 | hypothetical protein | - |
FEL10_RS09150 | 1965668..1966717 | + | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
FEL10_RS09155 | 1966730..1967101 | + | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
FEL10_RS09160 | 1967091..1967462 | + | 372 | WP_000090264.1 | antitermination protein | - |
FEL10_RS09165 | 1967614..1968432 | + | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
FEL10_RS09170 | 1968719..1968915 | + | 197 | Protein_1783 | TrmB family transcriptional regulator | - |
FEL10_RS09175 | 1969053..1969766 | + | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T125486 WP_000813263.1 NZ_CP040314:1965065-1965220 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T125486 NZ_CP040314:1965065-1965220 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT125486 NZ_CP040314:c1965053-1964995 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|